Property Summary

Ligand Count 9
NCBI Gene PubMed Count 67
PubMed Score 147.33
PubTator Score 143.11

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (15)

Disease log2 FC p
cystic fibrosis 1.440 8.3e-06
glioblastoma 1.700 4.5e-04
hepatocellular carcinoma 1.400 2.1e-05
intraductal papillary-mucinous adenoma (... 1.100 3.3e-02
lung cancer -2.100 1.0e-02
lung carcinoma -2.400 1.1e-37
malignant mesothelioma 1.100 3.3e-05
Multiple myeloma 1.066 2.5e-02
non-small cell lung cancer -1.170 2.5e-12
osteosarcoma -1.571 8.5e-04
ovarian cancer -1.600 1.0e-04
pituitary cancer -1.400 2.9e-05
psoriasis 1.100 1.2e-126
subependymal giant cell astrocytoma 1.658 3.9e-02
ulcerative colitis 1.600 1.3e-05

 GWAS Trait (1)

Gene RIF (45)

AA Sequence

MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADSMQEKQRMAGQ      1 - 70
MLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALI     71 - 140
ICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSH    141 - 210
GILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASS    211 - 280
QSSENLEEDAVYKTHVEKDFIAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSF    281 - 350
ETPRAKAQMPTIERLSMTRYFYLFPGN                                               351 - 377
//

Text Mined References (78)

PMID Year Title