Property Summary

NCBI Gene PubMed Count 63
PubMed Score 137.52
PubTator Score 143.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
hepatocellular carcinoma 1.400 2.1e-05
Multiple myeloma 1.066 2.5e-02
malignant mesothelioma 1.100 3.3e-05
osteosarcoma -1.662 2.2e-04
cystic fibrosis 1.440 8.3e-06
glioblastoma 1.700 4.5e-04
non-small cell lung cancer -1.170 2.5e-12
intraductal papillary-mucinous adenoma (... 1.100 3.3e-02
lung cancer -3.700 8.5e-07
subependymal giant cell astrocytoma 1.658 3.9e-02
lung carcinoma -2.400 1.1e-37
ulcerative colitis 1.600 1.3e-05
ovarian cancer -2.000 4.0e-12
pituitary cancer -1.400 2.9e-05
psoriasis 1.100 1.2e-126

Gene RIF (41)

PMID Text
27003256 apoptosis is induced by rhein traditional Chinese medicine via induction of endoplasmic reticulum stress, caspase-4 and intracellular calcium in primary human hepatic HL-7702 cells
26508369 Caspase-4 and caspase-5 mediate IL-1alpha and IL-1beta release from human monocytes after lipopolysaccharides stimulation.
26174085 caspase-4 activation alone is sufficient to induce pyroptosis, this process depends on the NLRP3 inflammasome activation to drive IL-1beta maturation.
26173988 both caspase-4 and caspase-5 are functionally important for appropriate responses to intracellular Gram-negative bacteria.
25964352 implicate caspase-4 as a critical regulator of noncanonical inflammasome activation that initiates defense against bacterial pathogens in primary macrophages
25943872 this study has identified epithelial-expressed caspases-4 and -5 as biomarkers with diagnostic and therapeutic potential in colorectal cancer.
25695505 NF-kappaB can mediate Fas-induced apoptosis through caspase-4 protease
25487697 This study reveled that CASP4 having a central role in the bipolar disease and schizophrenia manifestation.
25121752 The caspase-4/11 inflammasome also governs activation of the proinflammatory cytokine, interleukin (IL)-18, in response to intracellular and extracellular enteric pathogens.
25119034 function of caspase-4/5/11 represents a new mode of pattern recognition in immunity and also an unprecedented means of caspase activation
24879791 caspase-4 can support activation of caspase-1 and secretion of IL-1beta and IL-18 in response to priming signals (LPS or Pam3CSK4) alon
24879640 Authors observed increases in the endoplasmic reticulum stress markers BiP and cleaved caspase-4 in Duchenne muscular dystrophy patient biopsies, compared with controls.
23845419 TLR3 stimulation in keratinocytes induces a caspase-4 dependent release of pro-IL-1beta, but further processing to active IL-1beta is limited. Furthermore, TLR3 stimulation results in pyroptotic- and apoptotic cell death.
23684308 Shigella OspC3 interacts with the caspase-4-p19 subunit and inhibits its activation by preventing caspase-4-p19 and caspase-4-p10 heterodimerization.
23661706 TMEM214 is essential for endoplasmic reticulum (ER) stress-induced apoptosis by acting as an anchor for recruitment of procaspase 4 to the ER and its subsequent activation.
22733992 These experiments identify caspase 4 as a novel regulator of TNF-alpha-induced NF-kappaB signaling that is required for the activation of I-kappaB kinase.
22246630 Caspase-4 expression is essential for efficient nucleotide-binding domain leucine-rich repeat containing, Pyrin domain containing-3 and for absent in melanoma 2 inflammasome-dependent proIL-1beta activation in macrophages
21984918 Levels of c-Rel directly modulated expression of caspase-4 as well as other endoplasmic reticulum stress genes.
21781452 Loss of heterozygosity contributes to tumor progression of oral squamous cell carcinoma, and a specific role for PDCD4, CTNNB1, and CASP4 was found.
21479362 GRP78, CHOP, caspase 4, and caspase 3 may be involved in adenosine-induced HepG2 cell apoptosis
21317160 Data suggest that Casp4, Casp 6 and TNFSF10 are differentially expressed in potentially fertile and subfertile men and represent useful biomarkers for predicting male fertility in combination with P1 and P2.
21282934 results suggest that caspase-4 directly activates caspase-9 by the processing of procaspase-9 at Asp-315 in endoplasmic reticulum stress-induced neuronal apoptosis
20855536 Observational study of gene-disease association. (HuGE Navigator)
20816908 Neuronal cell death is induced via cleavage of caspase-4 in endoplasmic reticulum cells under stress in vitro.
20514521 results show that activation of caspase-4 contributes to TRAIL-induced apoptosis and is associated with induction of ER stress by TRAIL in melanoma cells
20453000 Observational study of gene-disease association. (HuGE Navigator)
20402676 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19705160 This study suggests a possible role of caspase-4 in the apoptotic loss of proximal tubular cells.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19414860 Observational study of gene-disease association. (HuGE Navigator)
19269008 somatic mutation of the CASP4 gene is common in gastrointestinal stromal tumor & suggest a possibility that CASP4 mutation might lead to alteration of apoptotic or inflammatory function & contribute to pathogenesis of some gastrointestinal stromal tumors
19269008 Observational study of gene-disease association. (HuGE Navigator)
18056395 TRAF6-caspase-4 interaction, triggered by LPS, leads to NF-kappaB-dependent transcriptional up-regulation and secretion of important cytokines and chemokines in innate immune signaling in human monocytic cells.
18029041 These results demonstrate that induction of GADD153/CHOP plays a pivotal role in mechanism of ER stress-induced cell death in SH-SY5Y cells, on the other hand, cleavage of pro-caspase-4 by activation of calpain play a crucial role in SK-N-SH cells.
17942194 the familial Alzheimer's disease-linked presenilin 1 mutation accelerates the cleavage of caspase-4 under the endoplasmic reticulum stress
16920334 Cop inhibition of cell death, at least to a certain extent, results from its interference with the activation of caspase-1 and caspase-4.
15975932 caspase-12 and caspase-4 are not required for the induction of ER stress-induced apoptosis and that caspase-4-like activity is not always associated with an initiating event.
15326478 resistance of pro-interleukin-18 to processing by caspase 1 in ovarian tumors
15123740 Caspase-4 can function as an ER stress-specific caspase in humans, and may be involved in pathogenesis of Alzheimer's disease.

AA Sequence

MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADSMQEKQRMAGQ      1 - 70
MLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALI     71 - 140
ICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSH    141 - 210
GILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASS    211 - 280
QSSENLEEDAVYKTHVEKDFIAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSF    281 - 350
ETPRAKAQMPTIERLSMTRYFYLFPGN                                               351 - 377
//

Text Mined References (73)

PMID Year Title
27003256 2016 Rhein triggers apoptosis via induction of endoplasmic reticulum stress, caspase-4 and intracellular calcium in primary human hepatic HL-7702 cells.
26508369 2015 Human caspase-4 and caspase-5 regulate the one-step non-canonical inflammasome activation in monocytes.
26375003 2015 Cleavage of GSDMD by inflammatory caspases determines pyroptotic cell death.
26174085 2015 Caspase-4 mediates non-canonical activation of the NLRP3 inflammasome in human myeloid cells.
26173988 2015 NLRP3 inflammasome activation downstream of cytoplasmic LPS recognition by both caspase-4 and caspase-5.
25964352 2015 Human caspase-4 mediates noncanonical inflammasome activation against gram-negative bacterial pathogens.
25943872 2015 Altered expression of caspases-4 and -5 during inflammatory bowel disease and colorectal cancer: Diagnostic and therapeutic potential.
25695505 2015 NF-?B regulates caspase-4 expression and sensitizes neuroblastoma cells to Fas-induced apoptosis.
25487697 2015 Innate immune response is differentially dysregulated between bipolar disease and schizophrenia.
25121752 2014 Noncanonical inflammasome activation of caspase-4/caspase-11 mediates epithelial defenses against enteric bacterial pathogens.
25119034 2014 Inflammatory caspases are innate immune receptors for intracellular LPS.
24879791 2014 A critical role for human caspase-4 in endotoxin sensitivity.
24879640 2014 Caspase-12 ablation preserves muscle function in the mdx mouse.
23845419 2013 TLR3 mediates release of IL-1? and cell death in keratinocytes in a caspase-4 dependent manner.
23684308 2013 The Shigella OspC3 effector inhibits caspase-4, antagonizes inflammatory cell death, and promotes epithelial infection.
23661706 2013 Transmembrane Protein 214 (TMEM214) mediates endoplasmic reticulum stress-induced caspase 4 enzyme activation and apoptosis.
23516580 2013 The E. coli effector protein NleF is a caspase inhibitor.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22733992 2012 A genome-wide RNA interference screen identifies caspase 4 as a factor required for tumor necrosis factor alpha signaling.
22246630 2012 Caspase-4 is required for activation of inflammasomes.
21984918 2011 c-Rel deficiency increases caspase-4 expression and leads to ER stress and necrosis in EBV-transformed cells.
21781452 LOH at PDCD4, CTNNB1, and CASP4 loci contributes to stage progression of oral cancer.
21479362 2011 Involvement of endoplasmic reticulum stress in adenosine-induced human hepatoma HepG2 cell apoptosis.
21317160 2011 Apoptotic gene expression in potentially fertile and subfertile men.
21282934 2011 Caspase-4 directly activates caspase-9 in endoplasmic reticulum stress-induced apoptosis in SH-SY5Y cells.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20816908 2010 Familial amyotrophic lateral sclerosis (FALS)-linked SOD1 mutation accelerates neuronal cell death by activating cleavage of caspase-4 under ER stress in an in vitro model of FALS.
20514521 2010 TRAIL-induced apoptosis of human melanoma cells involves activation of caspase-4.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20402676 2010 Mutational analysis of caspase genes in prostate carcinomas.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19705160 2010 Caspase-4 may play a role in loss of proximal tubules and renal injury in nephropathic cystinosis.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19414860 2009 Genetic variation in caspase genes and risk of non-Hodgkin lymphoma: a pooled analysis of 3 population-based case-control studies.
19269008 2009 Mutational analysis of CASP1, 2, 3, 4, 5, 6, 7, 8, 9, 10, and 14 genes in gastrointestinal stromal tumors.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18511561 2008 A NOD2-NALP1 complex mediates caspase-1-dependent IL-1beta secretion in response to Bacillus anthracis infection and muramyl dipeptide.
18056395 2007 Caspase-4 interacts with TNF receptor-associated factor 6 and mediates lipopolysaccharide-induced NF-kappaB-dependent production of IL-8 and CC chemokine ligand 4 (macrophage-inflammatory protein-1 ).
18029041 2008 Distinct mechanism of cell death is responsible for tunicamycin-induced ER stress in SK-N-SH and SH-SY5Y cells.
17942194 Presenilin-1 mutation activates the signaling pathway of caspase-4 in endoplasmic reticulum stress-induced apoptosis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16920334 2006 Protective role of Cop in Rip2/caspase-1/caspase-4-mediated HeLa cell death.
16893518 2006 Identification of a novel exon encoding the amino-terminus of the predominant caspase-5 variants.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15975932 2005 Caspase-12 and caspase-4 are not required for caspase-dependent endoplasmic reticulum stress-induced apoptosis.
15500642 2004 Plakin proteins are coordinately cleaved during apoptosis but preferentially through the action of different caspases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15326478 2004 A novel isoform of pro-interleukin-18 expressed in ovarian tumors is resistant to caspase-1 and -4 processing.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15123740 2004 Involvement of caspase-4 in endoplasmic reticulum stress-induced apoptosis and Abeta-induced cell death.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12096920 2002 Interleukin-1F7B (IL-1H4/IL-1F7) is processed by caspase-1 and mature IL-1F7B binds to the IL-18 receptor but does not induce IFN-gamma production.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10986288 2000 Expression analysis of the human caspase-1 subfamily reveals specific regulation of the CASP5 gene by lipopolysaccharide and interferon-gamma.
10872455 1999 Mammalian caspases: structure, activation, substrates, and functions during apoptosis.
10477277 1999 Caspase-1 (interleukin-1beta-converting enzyme) is inhibited by the human serpin analogue proteinase inhibitor 9.
10329646 1999 Nod1, an Apaf-1-like activator of caspase-9 and nuclear factor-kappaB.
10069390 1999 Identification of caspases that cleave presenilin-1 and presenilin-2. Five presenilin-1 (PS1) mutations do not alter the sensitivity of PS1 to caspases.
9875225 1998 Cleavage of human cytosolic phospholipase A2 by caspase-1 (ICE) and caspase-8 (FLICE).
9792675 1998 Caspase-14 is a novel developmentally regulated protease.
9694885 1998 Cytotoxic T lymphocyte-assisted suicide. Caspase 3 activation is primarily the result of the direct action of granzyme B.
9539746 1998 Bcl-XL interacts with Apaf-1 and inhibits Apaf-1-dependent caspase-9 activation.
9250871 1997 Interleukin-1beta-converting enzyme (ICE) and related cell death genes ICErel-II and ICErel-III map to the same PAC clone at band 11q22.2-22.3.
9233763 1997 Involvement of caspase-4(-like) protease in Fas-mediated apoptotic pathway.
8962078 1996 Molecular ordering of the Fas-apoptotic pathway: the Fas/APO-1 protease Mch5 is a CrmA-inhibitable protease that activates multiple Ced-3/ICE-like cysteine proteases.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7797592 1995 Molecular cloning and pro-apoptotic activity of ICErelII and ICErelIII, members of the ICE/CED-3 family of cysteine proteases.
7797510 1995 Identification and characterization of ICH-2, a novel member of the interleukin-1 beta-converting enzyme family of cysteine proteases.
7743998 1995 A novel human protease similar to the interleukin-1 beta converting enzyme induces apoptosis in transfected cells.
1919001 1991 IL-1-converting enzyme requires aspartic acid residues for processing of the IL-1 beta precursor at two distinct sites and does not cleave 31-kDa IL-1 alpha.