Property Summary

NCBI Gene PubMed Count 881
PubMed Score 16628.38
PubTator Score 9598.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

See source...

MLP Assay (26)

AID Type Active / Inconclusive / Inactive Description
463141 screening 350 / 0 / 325786 Absorbance-based primary biochemical high throughput screening assay to identify activators of procaspase-3
463197 summary 0 / 0 / 0 Summary of the probe development efforts to identify activators of procaspase-3
488856 screening 48 / 0 / 1382 Single concentration confirmation of UBC13 Polyubiquitin Inhibitors using a Caspase-3 counter screen
488901 confirmatory 668 / 0 / 36 Dose Response confirmation of inhibitors of Sentrin-specific proteases (SENPs) using a Caspase-3 Selectivity assay
488918 screening 3691 / 0 / 2505 Single concentration confirmation of inhibitors of Sentrin-specific proteases (SENPs) using a Caspase-3 Selectivity assay
488954 screening 18 / 0 / 192 Absorbance-based confirmation biochemical high throughput confirmation assay for activators of procaspase-3
489014 confirmatory 7 / 0 / 18 Absorbance-based biochemical high throughput dose response assay for activators of procaspase-3
493114 screening 5 / 0 / 283 Counterscreen assay for dual activators of procaspase-3 and procaspase-7: Absorbance-based biochemical assay for activators of procaspase-3
504328 confirmatory 0 / 0 / 17 Dose response counterscreen for dual activators of procaspase-3 and procaspase-7: Absorbance-based biochemical high throughput screening assay to identify activators of procaspase-3
504488 confirmatory 117 / 0 / 150 SAR Analysis of small molecule inhibitors of Sentrin-specific proteases (SENPs) using a Caspase-3 Selectivity assay
More...

Gene RIF (744)

PMID Text
26978233 Expression of Caspase 3, including that of survivin, was significantly more frequently detected in the patients who had received combined cytotoxic and anti-VEGF therapy as compared to both those treated with only cytotoxic agents and the control group
26921582 Caspase-3 mainly degraded LMP1 proteins in HeLa cells, leading to decreased NF-kappaB and STAT3 activation. Caspase-3 cleaved the consensus DNTD sequences in the CTAR3 region of LMP1.
26823716 Expression of livin, survivin and caspase-3 are closely related to the occurrence and development of prostatic cancer.
26782454 These results suggest that CASP3 gene polymorphisms may be associated with susceptibility to periodontal disease in the Korean population
26762417 ilvestrol induced caspase-3 activation and apoptotic cell death in a time- and dose-dependent manner
26687534 These findings demonstrated that p21 plays a critical role in furazolidone-induced apoptosis in HepG2 cells by influencing the caspase-3 activation and ROS generation.
26595239 Suggest 2'5'-oligoadenylate synthetase 2 mediates T-cell receptor CD3-zeta chain down-regulation via caspase-3 activation in oral cancer.
26573276 The casp3 cleaved product of Beclin1 promotes apoptosis induced by S1 in SKOV3 cells.
26563540 Excessive TLR9 signaling contributed to maternal-fetal tolerance disruption via an effect on Treg cell survival by activation of Caspase 8/3
26545730 caspase-3 serum levels and mortality are associated in patients with severe traumatic brain injury
26526615 a novel cell fate determination mechanism to ensure cells undergo programed cell death through interfering with RPS3/NF-kappaB-conferred anti-apoptotic transcription by the fragment from partial p65 cleavage by activated Caspase-3
26516138 Increased miR-451 expression may negatively regulate Bcl-2 mRNA and protein expression, followed by affecting the protein expression of caspase 3, and accelerate the apoptosis in breast cancer
26507126 Cleaved caspase-3 expression was a predictor of biochemical progression in prostate cancer patients.
26469967 Caspase-3-enhanced Bid activation initiates the genistein induced cell death pathway.
26431328 In addition to acting as a key executioner in apoptosis, caspase 3 in dying tumor cells may play a central role in driving proangiogenic response after irradiation.
26397041 in vitro OGT knockdown induced more cell apoptosis through increasing PUMA and caspase-3 expression
26336824 FANCJ protein is important for the stability of FANCD2/FANCI proteins and protects them from proteasome and caspase-3 dependent degradation.
26334686 Rhizopus arrhizus cytochrome c can activate human caspase-3 in HeLa cell extracts
26307684 Low expression of CASP3 is associated with non-small cell lung cancer.
26263983 overexpression of miR-30b can improve the Hcy-induced apoptosis in HCAECs by downregulating caspase-3 expression. Therefore, miR-30b may play an important role in Hcy-induced apoptosis in endothelial cells
26257207 Targeting executioner procaspase-3 with the procaspase-activating compound B-PAC-1 induces apoptosis in multiple myeloma cells.
26161867 these data support a role for the activation of caspase-3 and proteolytic cleavage of Tau antibody in vascular dementia.
26109071 p120RasGAP shields Akt from deactivating phosphatases in FGF1 signaling, but loses this ability once cleaved by caspase-3.
26076991 GSAP cleavage via caspase-3 is regulated and depend upon the availability of 5-Lipoxygenase in Alzheimer's disease.
26076727 increased production of vascular endothelial growth factor by mesenchymal stromal cells facilitating AKT phosphorylation and inhibiting caspase 3-mediated apoptosis
26064904 Nonpeptidyl inhibitors of caspase-3 identified in the present study expeditiously mimic the inhibitory action of the previously identified peptidyl inhibitors
26055088 TNFRSF1A, CASP3 and CASP8 gene variants were not associated with Achilles tendinopathies in British Caucasians.
26045308 18)F-C-SNAT has significantly increased tumor uptake and significantly increased tumor-to-muscle ratio in a preclinical mouse model of tumor therapy.
26014377 Inhibition of Mcl-1 and activation of caspases are critically involved in gallotannin-induced apoptosis in prostate cancer cells.
25943894 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
25909216 Deficiency of caspase 3 in tumor xenograft impairs therapeutic effect of measles virus Edmoston strain.
25887904 The anti-Mycobacterium tuberculosis effects of IL-32gamma are mediated through classical caspase-3-dependent apoptosis as well as caspase-3-independent apoptosis.
25866249 Results show that human or mouse cells exposed to ionizing radiation or other stresses can survive with persistent caspase-3 activation, which in turn promotes genetic instability and oncogenic transformation.
25829401 We identified several genes (FasL, MSH2, ABCC5, CASP3, and CYP3A4)that showed association with PFS in patients with osteosarcoma. These pharmacogenetic risk factors might be useful to predict treatment outcome
25821312 Bleomycin A5 can increase caspase-3 and p53 levels and inhibit telomerase activity to induce ECV304 apoptosis.
25806508 In patients with HIV, serum CASP3 levels in a group with high CD4 cell counts increased rapidly then decreased within a short time during early HIV-1 infection. In contrast, CASP3 levels in the CD4Low group were increased after 1 year of HIV-1 infection.
25800561 Propose photosensitized benzophenone causes cytochrome c regulated caspase 3 dependent apoptosis in HaCaT cell line through down regulation of Bcl2/Bax ratio.
25748204 Preclinical studies identify non-apoptotic low-level caspase-3 as therapeutic target in pemphigus vulgaris.
25744832 IL-8 inhibits apoptosis by up-regulating Bcl-2 and down-regulating caspase-3 in breast cancer cell.
25738796 Downregulation of NIT2 inhibits colon cancer cell proliferation and induces cell cycle arrest through the caspase-3 and PARP pathways
25665064 Silver nanoparticles biosynthesized using Achillea biebersteinii flower extract: apoptosis induction in MCF-7 cells via caspase activation and regulation of Bax and Bcl-2 gene expression.
25662045 The purpose of this study was to comprehensively investigate the association between common genetic variants of CASP3 gene and AF in Chinese Han population.
25645462 The proportional increase in nuclear AT1 in dopamine neurons in nigrosome 1 of prePD and PD patients was accompanied by elevated nuclear expression of Nox4, oxidative damage to DNA, and caspase-3-mediated cell loss.
25619400 Early programmed cell death and the nonapoptotic functions of caspase-3 during early development of the neuroepithelium. [Review]
25578648 S-nitrosylation of XIAP Cys 213 impairs the anti-caspase 3 and anti-apoptotic function of XIAP.
25531894 Rabbit antithymocyte globulin facilitates apoptosis of alloreactive T cells by means of caspase-3 activation, which may explain its steroid-sparing effect in pediatric liver and intestine recipients.
25476481 Expression of caspase-3 in advanced gastric cancer is a predictor of poor response to treatment and survival.
25467409 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
25435190 Centipedegrass extract induces apoptosis through the activation of caspases and the downregulation of PI3K/Akt and MAPK phosphorylation in leukemia cells.
25352594 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
25343534 the caspase-3 native ensemble includes the canonical active state as well as an inactive conformation characterized by an intact substrate-binding pocket, but with an altered helix 3
25246356 The individual contribution of each Akt isoform in p120 RasGAP fragment N-mediated cell protection against Fas ligand induced cell death, was investigated.
25197379 Our study showed cleaved caspase-3 was well correlated to progression, aggressive behaviors in gastric, ovarian, cervical and colorectal cancer.
25189649 HER2 promotes tumor cell survival by inhibiting apoptosis i.e. by downregulating CASP-3 and CASP-8.
25180606 Proteinase 3-mediated caspase-3 activation controls neutrophil spontaneous death
25177685 B. serrata extract also caused dose dependent increase in caspase-3 activity, TNF-alpha level, and IL-6 level which was higher (P < 0.001) with DOX (1 muM).
25156550 this report suggests a novel finding that cellular signaling caspase 3/7-PKCdelta-Akt/p38 MAPK is crucial to the repopulation in Panc1 cells after radiotherapy.
25124665 results indicate a regulatory role of nascent histamine on expression of both caspase-3 and alpha-synuclein
25112874 Chemotherapeutic drugs also activated an alternative caspase- and Panx1-independent pathway for ATP release from Jurkat cells in the presence of benzyloxycarbonyl-VAD, a pan-caspase inhibitor.
25068691 Suggest that glucose might attenuate isoflurane-induced caspase-3 activation through a mitochondria-independent reduction in ROS levels and enhancement in ATP levels in neuroglioma cells.
25058453 An increase of cytoplasmic nuclear p21 and activated caspase-3 expression.
25058423 Caspase 3 cleaved REDD1 during apoptotic activation.
25041019 MiR-421 acts as a tumor promoter by targeting the caspase-3 gene.
25037599 CASP3 gene is up-regulated in LNCaP and PC-3 prostate cancer cell lines.
25002346 Rs4647693, rs4647610, and rs12108497 of CASP3 genes were correlated with gastric cancer susceptibility.
24980229 lower expression in patients with chronic rhinosinusitis with nasal polyposis
24969479 miR-221 can regulate apoptosis by modulating caspase-3 in different cancer cell lines.
24952432 Data suggest that D396N polymorphism of JmjC domain-containing histone demethylase JMJD2C affects the prognosis of breast cancer by altering caspase-3 cleavage and the ability of double strand DNA break repair which may contribute to therapy resistance.
24917042 Dual vulnerability of TDP-43 to calpain and caspase-3 proteolysis after neurotoxic conditions and traumatic brain injury.
24903211 CASP3 polymorphisms are associated with Kawasaki disease.
24839934 Data confirmed that levels of PinX1 and caspase 3, 8 and 9 expression were closely linked to the poor prognosis of colorectal cancer.
24810717 unmodified STAT1 is cleaved at multiple sites by caspase-3 and caspase-6 in malignant undifferentiated hematopoietic cells
24810056 Combination of a perforin (PF)-CEBPD prodrug (which increases level of procaspase-8) and a PF-granzyme B prodrug (which activates CASP8/CASP3)) showed an additive effect in triggering the apoptotic pathway/enhancing apoptosis in prostate cancer cells.
24792179 Knocking down WWP1 promoted cleaved caspase3 protein and p53 expression in hepatocellular carcinoma cells, and caspase3 inhibition could prevent cell apoptosis induced by the knockdown of WWP1.
24764681 Caspase-3 expression in metastatic LNs may be a potential independent predictor of poorer overall survival in patients with resected ESCC and LN metastasis
24691971 we observed activation of the effector caspases-3, induced by activation of the initiator caspases -8 and -9, which subsequent trigger both death receptor pathway and the mitochondrial apoptotic pathway in licochalcone A-mediated SCC-25 cell apoptosis
24607276 Caspase-3 activation is part of a pathway of growth inhibition in cancer stem cells induced by a synthetic flavagline.
24583153 Patients with lipodystrophy had higher expression of TNF-alpha and caspase-3 and lower TGF-beta, compared to the control group.
24573549 Data indicate that accumulation of [(18)F]FB-VAD-FMK agreed with elevated caspase-3 activity in human xenograft colorectal and colon cancer tissues.
24561085 Among the tumors, there were reasonable to good positive correlations between the expression of FasL and Fas (r=0.47) and between Fas and cleaved caspase-8 (r=0.41), and there were poor positive correlations between Fas and cleaved caspase-3 (r=0.26)
24553140 findings demonstrate that caspase 3 activation in the presence of a common risk allele leads to accelerated degradation of ATG16L1, placing cellular stress, apoptotic stimuli and impaired autophagy in a unified pathway that predisposes to Crohn's disease
24496691 Results suggest that dioscin possessed potential anti-tumor activity in LNCaP prostate carcinoma cells through the apoptosis pathway, which might be associated with caspase-3 and Bcl-2 protein family.
24466265 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
24434746 Caspase 3 has a role in promoting surviving melanoma tumor cell growth
24434142 Data show that sangivamycin induced the apoptosis of primary effusion lymphoma (PEL) cells by activating caspase-7 and -9 and suppressed the phosphorylation of Erk1/2 and Akt, thus inhibiting activation of the proteins.
24418364 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
24363090 The combination of caspase-3 and caspase-6 aggravates tau truncation at aspartate 421.
24362034 HuR undergoes cleavage modification by caspase-3 following IR-induced oral mucositis and subsequently promotes the expression of the pro-apoptotic factor BAX (Bcl-2-associated X protein), as well as cell death.
24347041 These results indicate that stress-activated caspase-3 might contribute to the suppression of metastasis through the generation of fragment N2( RasGAP )
24338704 Over-expression of CASP3 gene could have a role in the activation of the apoptotic pathways acting in the neurodegenerative processes in Down's syndrome.
24268429 TSSC3 overexpression suppressed osteosarcoma cell growth and increased apoptosis through caspase-3 upregulation
24265318 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
24252910 In addition, overexpression of has-let-7g negatively regulated apoptosis in the endothelial cells by targeting caspase-3 expression
24204256 PKC activation then triggered activation of cdk-2, which became further activated by caspase-3.
24161344 MA-1 treatment causes release of cytochrome c into the cytosol, leading to activation of caspases 3 and 9.
24129493 Hsa-miR-30b and hsa-miR-30c are negative regulators of cell death induced by loss of attachment through down-regulation of caspase 3 expression.
24123326 we show that heat shock induces exosomal transfer of HSF1 from Sca-1(+) cells, which directs ischemic cardiomyocytes toward a prosurvival phenotype by epigenetic repression of miR-34a
24122846 found that both caspase-3 sites in Death Defying Domain are necessary for inhibition of caspase-3 and promotion of cell survival
24113184 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
24058658 study revealed robust activation of the uterine myocyte endoplasmic reticulum stress response and its adaptive unfolded protein response during pregnancy coinciding respectively with increased uterine caspase-3 activity
24028796 The results suggest that TSLP may down-regulate caspase3 expression through activation of the STAT3 pathway, thereby suppressing the apoptosis of decidual gammadelta T cells.
24009453 Report significantly higher active caspase-3 concentration in hormone responsive gallbladder carcinoma, which exhibits high apoptotic activity.
23979166 Inhibition of activated CASP7 by X-linked inhibitor of apoptosis protein is a potential mechanism by which apoptosis is prevented in those cancer cells deficient in casp3.
23949910 (18)F-ICMT-11 is a safe PET tracer with a dosimetry profile comparable to other common (18)F PET tracers
23907941 The upregulation of Bax and Caspase-3 is an indication of ongoing apoptotic processes in the dermal microvascular endothelial cells of Mediterranean spotted fever patients.
23900644 Data indicate that the selenium compounds increased BAX, BCL-2 and activated caspase 3 levels.
23894522 a combinatorial association between ITPKC (rs28493229) and CASP3 (rs113420705) was found in coronary artery lesion formation (P = 0.0227, OR: 3.06)in Taiwanese population
23892923 In leukemia cells, inhibition of granzyme B translated into reduced caspase-3 activation.
23867824 Reduced cathepsin B expression, effected by RNA interference, mimicked pharmacological inhibition of the enzyme and confirmed the contribution of cathepsin B to apoptotic events induced by DENV in HepG2 cells.
23846227 Control of tissue regeneration by Caspase-3 may represent an important process for maintaining tissue homeostasis. [Review]
23791066 A of functional SNP rs72689236 of CASP3 increases the risk for Kawasaki disease
23781587 Livin may inhibit apoptosis in cervical squamous cell carcinoma by downregulating caspase-3, thereby promoting disease progression.
23775301 It has potential roles in apoptosis of well differentiated carcinoma without metastases and in neurodegeneration of Alzheimer's disease.
23765963 These meta-analysis results demonstrated that CASP-3 and CASP-7 genetic polymorphisms are involved in the pathogenesis of cancer.
23732112 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
23728617 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
23724505 significantly increased in the villous trophoblasts of patients with preeclampsia, HELLP syndrome, and IUGR indicating increased placental apoptosis
23708668 The caspase-dependent cleavage of BLH was confirmed by cleavage of partly-purified human BLH with caspase-3.
23686572 mitochondria in a "non-canonical" pathway or mediates a mitochondrial feedback loop to amplify the apoptotic caspase signal in p14(ARF) -induced stress signaling.
23658722 activated caspase-3 to play a signalling role in erythroid differentiation by targeting mature BFU-E and CFU-E but not early BFU-E
23650375 Structural snapshots reveal distinct mechanisms of procaspase-3 and -7 activation.
23616419 The results showed a specific positive correlation between the levels of active Casp3 (17-19 kDa) and the inactive form of PARP1 (89 kDa) in lymphocytes isolated from newborn babies of diabetic women with unbalanced glycaemic control.
23599180 CK2alpha' exhibits a striking preference for caspase-3 phosphorylation in cells as compared to CK2alpha and that CK2beta exhibits the capacity to abolish caspase-3 phosphorylation
23591201 Using Cox's proportional hazards model, tumour stage, vascular invasion and expression of cleaved caspase 3 in tumour-associated stroma were shown to be independent markers of prognosis.
23568731 CASP3 probably plays an important role in Kawasaki disease (KD). The T allele of rs113420705 may provide a useful marker for KD susceptibility.
23555267 Hantavirus nucleocapsid protein inhibits the enzymatic activity of both granzyme B and caspase 3 thereby protecting infected cells from cytotoxic lymphocytes.
23545262 Knockdown of DAPK1 attenuates curcumin-induced inhibition of STAT3 and NF-kappaB. Moreover, DAPK1 suppression diminishes curcumin-induced caspase-3 activation.
23531848 elevated expression of nuclear survivin and caspase 3 in OSCC indicate that at the late stage survivin increases cell proliferation whereas caspase 3 promotes apoptosis
23531593 The release of caspase-3-enriched membrane vesicles and membrane blebbing are two differentially regulated processes.
23519117 Caspase-3 cleaves hnRNP K in erythroid differentiation.
23503461 EBNA-1 miRNA targets human casp3 expression to inhibit apoptosis.
23460086 increased in the fetal membranes of those women with preterm premature rupture of fetal membranes
23421973 Human mesenchymal stem cell-like cells from foreskin derived conditioned medium inhibited the expression of BCL-2 while increased the expression of BAX and caspase-3 in gastric cancer cells.
23416147 Increase in caspase-3 activity and no change in p53 activity with time in Canine Parvovirus-2 NS1 expressing HeLa cells showed the induction of apoptosis to be caspase dependent and p53 independent.
23386603 Substrate and inhibitor-induced dimerization and cooperativity in caspase-1 but not caspase-3
23384723 the evaluation of MMP2 in thyroid Papillary thyroid carcinoma appears to be of some benefit to the prediction of tumor behavior while Caspase-3 as a marker of prediction seems to be of no use.
23364796 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
23359247 increased active caspase-3 might be involved in Sertoli-cell-only syndrome etiology
23345589 in apoptotic cells, the myosin-binding domain of myosin phosphatase targeting subunit 1 is cleaved by caspase-3, and the cleaved MYPT1 is strongly phosphorylated at Thr-696 and Thr-853, phosphorylation of which is known to inhibit myosin II binding
23343959 Livin expression was positively correlated with the proliferation marker Ki-67, but was negatively correlated with caspase-3 expression in human ampullary carcinoma patients.
23326121 Apoptosis of HGC-27 cells induced by oridonin may be associated with differential expression of Apaf-1, caspase-3 and cytochrome c, which are highly dependent upon the mitochondrial pathway
23295106 Caspase-3 dependent apoptosis seems to be the most important, but not the only cell death pathway in ovaries.
23271418 we identified Caspase 3, BAG1 and BAG3 as key targets of ERalpha in neuronal cells that may play a role in ERalpha-mediated neuroprotection.
23271051 miR-885-5p binding site rs1049253T>C SNP in the 3'-UTR of CASP3 modulates CASP3 expression at both mRNA and protein levels and thus contributes to squamous cell carcinoma of the head and neck susceptibility.
23221544 Results show p27Kip1 and cyclin D3 are strongly associated with cellular differentiation, and, for the first time, show that up-regulation of p27Kip1 protects hES cells from inducing differentiation-associated and caspase 3-dependent apoptosis.
23220614 MAPK kinases induced by Isoorientin promote the cytochrome c release from the mitochondria into the cytosol via increasing the Bax/Bcl-2 ratio, then activate the caspase-3 and eventually result in apoptosis in HepG2 cells.
23202514 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
23170789 PAR2-AP or FVIIa elicited time-dependent downregulation of caspase-3, and up-regulation of MMP-9 and CD44 in SW620 cells.
23170075 Sepia ink oligopeptide induced cell cycle arrest and altered BAX/Bcl2 expression ratio and caspase-3 expression in prostate tumor cell lines.
23156805 Smac, XIAP, caspase 3 might be associated with the growth and carcinogenesis of nonnasal inverted papilloma.
23152053 Proteasome inhibition upregulates Bim and induces caspase-3-dependent apoptosis in mast cells expressing the Kit D816V mutation.
23122728 caspase 3-mediated truncation of IP(3)R channel is a consequence, not causative, of apoptotic calcium release.
23109891 EG also activated the death receptor-dependent pathway of apoptosis by enhancing the expression of caspases-8, -9, and -3 and the Bcl-2 interacting domain (Bid).
23103707 The activity of caspase -3 in red blood cells of chronic kidney disease children grows with progression of the disease.
23054082 ERF3 is targeted for caspase-mediated proteolytic cleavage and degradation during DNA damage-induced apoptosis.
22964638 Data indicate that miR-30b/c and miR-21 target respectively the 3' untranslated region of caspase-3 and TAp63 mRNAs.
22952982 Gelsolin modulation of cell death involved upregulation of TRAIL-R1 and TRAIL-R2, and involved caspase 3 activation by extrinsic pathway.
22951837 cleavage of CCHFV N by host cell caspase-3 appears to be crucial for controlling viral RNA synthesis
22949938 Knockdown of caspase recruitment domain (ARC) promoted caspase-8, caspase-3 activation and Bax accumulation in glioma.
22944165 Atorvastatin inhibits the H2O2-induced apoptosis of ECV-304 cells in a dose-dependent manner by downregulating casp3 and casp9.
22939953 Cleaved caspase-3 level is an ideal biomarker to predict prognosis in patients with pancreatic ductal adenocarcinoma.
22931643 Hyperbaric oxygenation combined with As(2)O(3) can increase the expression of caspase 3 mRNA and decrease the expression of HIF-1a and VEGF mRNA in K562 cells.
22926545 Data indicate that daidzein induced a change in the Bax/Bcl-2 ratios and activation of caspases-3 and -9 and the cleavage of PARP, and therefore has the potential for use as a therapeutic agent for the treatment of gastric carcinoma.
22912727 TRB3, through its own cleavage, functions as a molecular switch between the cell survival and apoptotic pathways under stressful conditions
22885173 We have shown that beta-methyl-amino-L-alanine induces the expression of neuronal nitric oxide synthase (nNOS) and caspase-3 indicating that it can stimulate apoptosis in human neurons.
22872644 Fibrils colocalize caspase-3 with procaspase-3 to foster maturation
22844442 CASP3 rs4862396, BMP5 rs3734444 and IRS2 rs7986346 may affect the survival in patients after androgen-deprivation therapy for prostate cancer
22837201 Human cytomegalovirus stimulates monocyte-to-macrophage differentiation via the temporal regulation of caspase 3
22832123 Besides its role in Vpr-mediated apoptosis induction caspase 3 influences the localization of Vpr at the nuclear envelope and thereby augments the Vpr-induced G2-arrest.
22832123 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
22796265 CASP3 plays a major role in neuronal apoptosis, nervous system development, neurodegenerative diseases, neurite pruning & synaptic plasticity. Review.
22764223 Ataxin 2 intermediate-length polyQ expansions contribute to amyotrophic lateral sclerosis by enhancing stress-induced TAR DNA-binding protein (TDP)-43 pathological modifications via CASP3 activation.
22683311 The binding of CSR1 with XIAP enhanced caspase-9 and caspase-3 protease activities.
22678593 Data indicate that Caspase-3-independent internucleosomal DNA fragmentation occurs in injured tubular epithelial cells undergoing irreversible necrosis in ischemic acute kidney injury (AKI).
22629415 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
22607239 A mutation in the allosteric site of the caspase 3 dimer interface of Val266 to histidine abolishes activity of the enzyme.
22568453 Our study suggests that CASP3 rs6948 might influence CASP3 expression and be associated with severe hematologic toxicity risk.
22552851 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
22541080 Component I from Agkistrodon acutus venom can effectively inhibit the growth and promote apoptosis of K562/A02 cells by upregulating caspase-3.
22504224 caspase-3 cleavage of MKP3 down-regulates MKP3 full length and renders active MKP3 fragments, which may participate in novel regulatory pathways controlling the subcellular localization and activation of ERK1/2 during apoptosis.
22496955 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
22489116 The increase in cell surface peptidase activity observed in cells undergoing ultraviolet B-induced apoptosis appears to involve PARP but not caspase 3.
22482362 Myricetin-induced apoptosis of T24 bladder cancer cells correlates with the modulation of Bcl-2 family proteins and activation of caspase-3.
22429842 A correlation (p = 0.0251) between TGF-beta and caspase-3 in the lepromatous leprosy was found.
22429811 Data suggest that pulmonary metastasis is corrected with levels of Geminin, cleaved caspase-3, CD44, E-cadherin, epidermal growth factor receptor, and CD204 in cancer cells within permeated lymphatic vessels.
22320973 The levels of cellular apoptosis-associated proteins such as Smac/DIABLO, Cyto C, and the activated fragment of caspase-3 increased in pancreatic cancer cells, but the expression of XIAP was significantly decreased after 24 h treatment with the combination of TRAIL and gemcitabine.
22309278 Human lactoferrin, an 80 kDa iron-binding glycoprotein, has antitumour effects... the potential therapeutic role of re-expressing human lactoferrin gene product in human breast cancer.
22302483 Data indicate that cathepsin D+/caspase 3- and cathepsin D+/p53+ showed clinicopathological significance.
22298410 Protocatechuic aldehyde inhibited LPS-induced HUVEC apoptosis in a dose-dependent manner by inhibiting caspase-3 activation.
22242595 Irradiation with (12)C(6+) significantly increased the expression of caspase-3 compared with the control group (p<0.05).
22216281 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
22191568 A dose-dependent increase in the activities of caspase-9 and caspase-3 coinciding with elevation of CK18 levels was found in bromelain-treated breast cancer cells.
22184067 identified a novel specific caspase-3 cleavage site in Par-4, and the cleaved fragment of Par-4 retains proapoptotic activity
22147199 Combination treatment with dihydrotanshinone I and irradiation enhances apoptotic effects in human cervical cancer by HPV E6 down-regulation and caspase-3 activation.
22136337 CASP3 829 A>C polymorphism may highly affect the function of caspase-3 and play an important role in the development of ESCC in Chinese populations
22121772 Baicalin inhibits oxidative stress-induced apoptosis in SH-SY5Y cells via reducing Caspase-3 expression and up-regulating SIRT1.
22094081 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
22013052 Human coronavirus-induced neuronal programmed cell death required cyclophilin d but not caspase 3 caspase 9 activities.
21987091 Functional single-nucleotide polymorphisms in ITPKC and CASP3 are associated with susceptibility to Kawasaki's disease (KD).
21959934 Loss of programmed cell death 4 induces apoptosis by promoting the translation of procaspase-3 mRNA.
21944661 Data show that the proliferation inhibitory effect of SKLB703 was associated with its apoptosis-inducing effect by activating caspase-3 and caspase-9.
21926353 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
21923740 Gaq controls the apoptosis of rheumatoid arthritis peripheral blood lymphocytes through regulating the activity of Mcl-1 and caspase-3.
21914347 Abnormal expression of Ezh2, Runx3 and caspase-3 is associated with the development and progression of endometrioid adenocarcinoma.
21880013 Data show that mRNA levels of the two main lysosomal enzymes (cathepsin B and L) were not changed but, conversely, genes related to calpain and caspase had a higher expression in the muscles of the patients.
21875325 Caspase-3 was activated to 6.4-fold in response to simultaneous treatment with sulforaphane and 17-AAG, whereas 17-AAG alone induced caspase-3 activity to 2-fold compared to control.
21869592 These findings suggest that neonatal neutrophils are intrinsically apoptosis-resistant, which may be due to the low expression of caspase-3.
21859712 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
21827945 procaspase-9 and caspase-3 have overlapping binding sites on the central hub of the apoptosome which play a crucial role in their activation
21819468 During physiological root resorption of human primary teeth, pulp apoptosis is likely to occur via caspase-3 activation through the mitochondrial intrinsic pathway.
21802116 Our results indicate that caspase expression in prostate malignant cells is reduced in a substantial number of patients and that such an alteration occurs in the premalignant stage.
21785112 Data indicate that NGA could increase the expression of the apoptosis-related proteins FasL, caspase-3, caspase-8, caspase-9, and Bax and decrease the expression of anti-apoptotic protein Bcl-2 accompanied by the mitochondrial transmembrane damage.
21775054 Data indicate that co-administration perifosine with paclitaxel in ovarian cancer cells led to the inhibition of AKT, and a striking increase in the activation of pro-apoptosis pathways, including caspase 3, JNK1 and AMPKalpha1.
21756903 some mutations in the C-terminus of GFAP correlate with caspase 3 cleavage and the loss of cell viability, suggesting that these could be contributory factors in the development of Alexander disease
21729540 Casp3 protein was activated in K562 cells treated with Clostridium difficile toxin A.
21725926 Increased apoptosis and the expression of FasL, Bax and caspase-3 in human lupus nephritis suggest that apoptosis might be induced through pathways of these proteins in the pathogenesis process.
21724551 Mechanistic studies showed that MLN2238-triggered apoptosis is associated with activation of caspase-3, caspase-8, and caspase-9.
21706480 Our results suggest that deregulated miR-155 promotes Fas-mediated apoptosis in human intervertebral disc degeneration by targeting FADD and caspase-3
21700414 Association of death receptor 4, Caspase 3 and 5 gene polymorphism with increased risk to bladder cancer in North Indians.
21682651 andrographolide induces apoptosis via inhibiting NF-kappaB-induced bcl-2-mediated survival signaling and modulating p53-induced caspase-3-mediated proapoptotic signaling.
21671484 CASP3 gene polymorphisms and its haplotypes were not related to the susceptibility of breast cancer.
21668377 Data suggest a positive association of caspase-3 and diplotype analysis of caspase-5 to be associated with prostate cancer risk.
21667042 Percentages of activated caspase-3 and activated caspase-8 are higher in chronic hepatitis C virus-infected patients. Treatment with GS-9450 resulted in a slight decrease in caspase-8 but a higher drop in caspase-3.
21644232 he polymorphism of CASP3 rs12108497 might be associated with the risk of stomach cancer
21644054 is a key players of head and neck squamous cell carcinoma and Parkinson disease through regulation of apoptosis pathway.
21624464 Bcl2-A1 interacts with pro-caspase-3 via its carboxyl-terminal helix alpha9 in transgenic mouse model of amyotrophic lateral sclerosis..
21561870 Caspase-3 cleavage links delta-catenin to the novel nuclear protein ZIFCAT.
21555338 DNA fragmentation was accompanied by increased caspase-9 and caspase-3 activities.
21548803 Apigenin increases CASP3 and CASP8 mRNA expression but decreases mTOR and CCND1 mRNA expression in HT29 cells.
21506333 Evaluating the activity of the apoptosis-regulating genes from Bcl-2, Bax expression, and caspase-3 activity in bronchial epithelial cells in patients with asthma
21504623 Findings indicate that HBx exerts pro-apoptotic effect upon exposure to oxidative stress probably through accelerating the loss of Mcl-1 protein via caspase-3 cascade.
21484410 Cathepsin L is present in the nucleus and regulates the transcription of effector caspases 3 and 7, in a p53 dependent manner.
21483669 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
21483469 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
21479362 GRP78, CHOP, caspase 4, and caspase 3 may be involved in adenosine-induced HepG2 cell apoptosis
21441410 The requirement for caspase-3 for chemically induced mitotic slippage reveals a new mechanism for mitotic exit and a link between mitosis and apoptosis
21437568 Erythrocyte caspase-3 activation fom type 2 diabetic patients is significantly higher than that form the control erythrocyte.
21382445 Data suggest that mainly caspase-3 and -9 participate in the agaritine induced apoptotic pathway.
21317880 Co-expression of caspase-3 and XIAP identified high-grade ovarian serous carcinomas with different prognosis.
21307660 tumor-derived mutants of p53 may be selected for in tumor cells due to their ability to bind and inhibit the activation of caspase-3.
21270757 caspase-3 activity in papillary carcinoma tissue was higher compared to unchanged thyroid tissue of normofollicular structure
21255440 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
21248767 TRAIL can be an inducer of both differentiation and apoptosis in human keratinocytes, and that caspases critically mediate these processes
21237154 Data suggest that caspase 3-mediated cleavage of JIP1 scaffold proteins may represent an important mechanism for modulation of JNK signalling during apoptotic cell death.
21223758 Paeoniflorin can significantly induce the apoptosis of HeLa cells through a down-regulation of anti-apoptotic gene Bcl-2 and an up-regulation of pro-apoptotic genes Bax and Caspase-3.
21216952 Regulator of calcineurin 1 (RCAN1) facilitates neuronal apoptosis through caspase-3 activation.
21203962 The Beclin 1 is a dual regulator for both autophagy and apoptosis. In this study we found that Beclin 1 was a substrate of caspase-3 with two cleavage sites at positions 124 and 149, respectively.
21178828 Data show that the expression of apoptosis proteins caspase-3,-8,-9, and Bid in the RNP of the disc and the SNP was different in each patient.
21160486 A borderline significant association was found between the genotypes and gene frequency of CASP3 in control subjects and KD patients. The A allele of CASP3 in KD patients and in those with coronary vessel had a higher frequency.
21151026 Caspase-3-mediated degradation of condensin Cap-H regulates mitotic cell death.
21142842 Activation of caspases 3/7 and 9 was detected during study of the mechanism by which amine-modified polystyrene nanoparticles induce cell death in a human brain astrocytoma cell line.
21123558 Caspase 3 is found to be required for increased superoxide production during neuronal apoptosis.
21123175 Crimean-Congo hemorrhagic fever virus induces apoptosis, which may be dependent on caspase-3 activation
21099299 Cleaved caspase-3 immunocytochemical staining for pancreatic islets and pancreatic endocrine tumors: A potential marker for biological malignancy.
21099290 The more positive staining for caspase-3 in islets from type 1 diabetics may correspond to accelerated apoptosis cascade in the islets before processing to eventual cell death.
21098975 Caspase-3 induced cleavage of tau can also be triggered by herpes simplex virus type 1 infection in primary neuronal and astrocyte cultures, inducing neurodegenerative processes in age-associated pathologies.
21081164 Beclin-1 is depleted in Alzheimer's disease brain following caspase-3 cleavage.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21029675 The activations of caspase-3 and P38 MAPK were involved in ciglitazone-induced cell apoptosis.
20981869 The anticancer activity of Caudatin-2,6-dideoxy-3-O-methy-beta-D-cymaropyranoside 1 (CDMC) could be attributed partially to its inhibition of cell proliferation and induction of apoptosis associated with caspase 3 activation.
20966960 These results identify TCTP-bearing nanovesicles as a novel component of the paracrine apoptotic program of potential importance in vascular repair.
20962079 We show that HIV-1 infection induced a proapoptotic profile in blood mDCs, defined as reduced Bcl-2 expression and increased frequencies of caspase-3+ mDCs in a subset of subjects that was associated with viral replication.
20959405 Observational study of gene-disease association. (HuGE Navigator)
20950443 Sorafenib displays significant antiproliferative effects and induces apoptosis via caspase 3, 7 and PARP in B- and T-lymphoblastic cells
20947770 in intestinal epithelium infection S Typhimurium SipA was responsible for activation of Casp3 which is required for SipA cleavage at specific recognition motif dividing it into 2 functional domains and activated SipA in a manner needed for pathogenicity
20929126 After UVB treatment, Bcl-2 levels increased and casp3 and survivin levels decreased in patients with psoriasis vulgaris, restoring expression to near-normal.
20919853 Caspase 3a: new prognostic marker for diffuse large B-cell lymphoma.
20862799 The expression of Caspase-3 in epithelial ovarian cancer was significantly lower than that in benign ovarian tumor and normal ovarian tissue.
20856198 Data show that show here the XIAP depletion to essentially require initial caspase-mediated cleavage.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20839416 TRAIL, its death receptor DR5 and caspase 3 were detected in the intima and media layers of newly formed vessels affected in affected temporomandibular joint discs.
20814064 A new dimension clarifies superoxide-mediated caspase-3 activation that leads to the development of endothelial dysfunction and atherosclerosis.
20801175 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
20738749 This study found differential caspase-3 expression indicating apoptosis-induced irreversible cell death in displaced TMJ discs with and without reduction, possbily relating to the topography of disc damage and the progression of this common disorder.
20723300 Bortezomib can inhibit the proliferation and induce the apoptosis of CA46 cells, which may involve the reduction of BCL-2 and the activation of caspase 3.
20722551 highest expression level of proC-3 was observed in anaplastic large cell lymphoma
20702410 a central and so far underappreciated role of caspase-8 dimerization/dissociation in avoiding unwanted cell death by lethal amplification of caspase responses via the caspase-8, -3, -6 loop.
20683843 Taspine can inhibit the proliferation of, and induce apoptosis in, A431 cells by activating caspase-3 expression and up-regulating the ratio of Bax/Bcl-2.
20683021 No associations among the levels of CPP32 and Ki-67 expression were observed in the various groups, neither among parameters such as age, gender or alcohol and tobacco consumption.
20667824 cIAP1 cooperatively interacts with oligomerized processed caspase-9 in the apoptosome and blocks procaspase-3 activation.
20665667 Overexpression of PKCdelta inhibits caspase-8 activation leading to inhibition of TRAIL-induced apoptosis and its inhibition by rottlerin, siRNA, or cleavage by caspase-3 sensitizes cells to TRAIL-induced apoptosis.
20661084 Single Nucleotide Polymorphisms in CASP3 is asspciated with lung cancer.
20661084 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20632819 The more cleaved caspase-3 immunostained islets from type 2 diabetics may implicate an accelerated apoptotic cascade in the islets, accompanied by increasing amyloid deposits, before proceeding to ultimate cell death.
20628645 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20619728 expression elevated in coal-combustion-type fluorosis
20598358 Ki-67, bcl-2 and caspase-3 positive cells changed in a temporally and spatially restricted manner coincident with upper jaw differentiation
20580881 CASP3 expression levels were significantly decreased in patient with schizophrenia.
20566630 Human caspase-3 and -7 exhibit differences in protease activity, specific homodimer-forming activity, and three-dimensional structural features, all of which are closely interrelated.
20530714 PHF10 repressed caspase-3 expression and impaired the programmed cell death pathway in human gastric cancer at the transcriptional level.
20512574 Data suggest that the induction of apoptosis by tanshinone I in leukemia cells is mainly related to the disruption of Deltapsim, inactivation of PI3k/Akt signaling pathway, upregulation of Bax expression, and the activation of caspase-3.
20492341 Hypermethylation downregulates Runx3 gene expression and its restoration suppresses gastric epithelial cell growth by inducing p27 and caspase3 in human gastric cancer.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20450729 Prunella vulgaris shows a strong inhibitory effect upon the growth of lymphoma cell line Raji by activating the of JNK pathway and increasing Casp3 expression.
20424172 Caspase-3 cleaves specific 19 S proteasome subunits in skeletal muscle stimulating proteasome activity
20423928 Altered CASP3 expression in immune effecter cells influences susceptibility to Kawasaki disease.
20423928 Observational study of gene-disease association. (HuGE Navigator)
20404718 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
20402676 Observational study of gene-disease association. (HuGE Navigator)
20383567 RANK-Fc suppressed OS cell migration, invasion ability, and anchorage-independent ability in collagen-1 gel (P < 0.005) following induction of anoikis and activation of caspase-3.
20346214 Thermo-chemotherapy has a stronger inhibitory effect than chemotherapy alone in lung tumor cell growth, probably through induction of ROS production and subsequent inhibition of Akt pathway activation and Caspase pathway-induced cancer cell apoptosis.
20340172 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
20307198 Report synergistic caspase-3 induction and apoptotic effects of imatinib and fludarabine in human K562 chronic myeloid leukemia cells.
20299368 Observational study of gene-disease association. (HuGE Navigator)
20227371 Mitochondrial and cytosolic transfer RNA (tRNA) bind to cytochrome c preventing cytochrome c interaction with Apaf-1, blocking Apaf-1 oligomerization and caspase activation.
20198319 A photosensitizer conjugated to a small-molecule PSMA inhibitor is capable of selectively initiating apoptosis via the caspase-8/-3 pathway in PMSA+ prostate tumor cells upon low-intensity light irradiation.
20180022 AE2 mediated-apoptosis of endothelial cells induced by high glucose was Caspase-3-dependent.
20150439 intracellular IGFBP-2 regulates caspase-3 expression and contributes to the inhibitory effect on apoptosis independent of IGF
20142237 colorectal microadenoma showed high levels of Caspase-3 active and low levels of Bcl-2 expression
20104682 The abnormal expression of survivin and caspase-3 may play important role in the pathogenesis of juvenile laryngeal papilloma.
20103643 Findings suggest that EWS/FLI1 induces apoptosis, at least partially, through the activation of CASP3.
20101263 p3-mediated specific cleavage activity abrogates the NES function in caspase-3, thus facilitating the nuclear entry of active caspase-3.
20087649 Reveal a novel function of HspB2 as an anti-apoptotic protein that negatively regulates apical caspase 3/8 activation in the extrinsic apoptotic pathway.
20085765 Data show H2O2-induced caspase-dependent apoptosis was strongly suppressed by silencing of Noxa, indicating that Noxa plays a crucial role in this form of apoptosis.
20072652 Data show that LLL12 inhibited STAT3 phosphorylation, induced apoptosis as indicated by the increases of cleaved caspase-3 and poly (ADP-ribose) polymerase, and also downregulated cyclin D1, Bcl-2, and survivin at both protein and messenger RNA levels.
20068062 Damage-independent activation of caspase-3 and PARP in FA cells, which seems to occur through mitogen-activated protein kinase activation and TNF-alpha oversecretion.
20063052 Adenosine downregulated the expression of mRNAs and proteins for Bcl-X(L) and inhibitor of apoptosis protein 2 (IAP2) to directly inhibit caspase-3, -7, and -9, but upregulated the expression of mRNA and protein for DIABLO, an inhibitor of IAPs.
20060927 Resveratrol significantly enhanced cigarette smoke-stimulated caspase 3 and caspase 9 activity in human bronchial epithelial cells.
20045442 Data show that EriB inhibited lymphoma cell proliferation and induced apoptosis in association with caspase 3 activation, and reduced Bcl-2/Bax and Bcl-xL/Bax ratios.
20042134 rhEPO can significantly inhibit the activity of caspase-3 or caspase-9 in endothelial cell apoptosis in a dose-dependent manner.
20041182 The calcium-calpain-caspase-12-caspase-3 cascade is altered in F508del-CFTR expressing cells.
20038816 Sorafenib inhibits ERK1/2 and MCL-1(L) phosphorylation levels resulting in caspase 3-independent cell death in malignant pleural mesothelioma
20025478 The decreased detection of active caspase-3 and ssDNA and the increased presence of Bcl-2 in T1 carcinomas suggest that alterations in interrelated apoptosis markers may play an important role in the progression of urothelial carcinoma.
20012528 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
20001963 Ets-1 is processed in a caspase 3-dependent manner.
19996278 Results show that wild-type p53 protects cells from caspases dependent death induced by this therapeutic combination in vitro.
19996275 Data indicate that overexpression of AT2R led to apoptosis via an extrinsic cell death signaling pathway that is dependent on activation of p38 mitogen-activated protein kinase, caspase-8, and caspase-3 and p53.
19996272 Studies show that BMS-754807 is a reversible inhibitor of the insulin-like growth factor 1 receptor/insulin receptor and increases poly ADP ribose polymerase and Caspase 3 cleavage.
19996122 Data suggest a role for GPIIbIIIa integrin in caspase-3 activation induced by these platelet agonists.
19956888 p21Waf1/Cip1 cleavage, which is mediated by caspase-3 activity, is involved in roscovitine-induced apoptosis
19942343 Triptolide induces caspase-3-dependent Mcl-1 cleavage, which may potentiate apoptosis in human myeloproliferative disorder cells.
19937139 enzymatic activity is directly suppressed by glyceraldehyde-3-phosphate
19925402 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
19913121 Observational study of gene-disease association. (HuGE Navigator)
19895210 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
19878567 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
19854241 Our current finding of decreased Bcl-2 and increased capase-3 in the cerebellum of autistic subjects further supports the suggestion that increased apoptosis may be involved in the pathogenesis of autism
19840460 2-methoxyestradiol can regulate the apoptosis of myelodysplastic syndrome cells through down-regulating the expression of mcl-1 mRNA and activating caspase-3.
19838207 Data show that hypoxia induces TG2 expression through HIF-1 dependent pathway, and activation of TG2 inhibites caspase-3 activity by forming crosslinked multimer, and activates nuclear factor (NF)-kappaB pathway.
19826114 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19812265 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
19807657 The presence of FoxO3a is necessary for the expression of cleaved (active) caspase 3, 8, and 9
19788411 Data show that the direct activation of procaspase-3 through a conformational switch rather than by chain cleavage may lead to novel therapeutic strategies for inducing cell death.
19788069 The level of caspase-3 expression started to increase in 2 hours after brain contusion and continued to increase for 1-2 days and maintained a high level for 3-5 days.
19784808 Data show that inhibition of NFAT3 activation by shNFAT3 significantly downregulated tumor necrosis factor (TNF)-alpha induction, its receptor TNFR1, caspase 10, caspase 3, and poly (ADP-ribose) polymerase.
19774677 Our current findings, suggesting decreased levels of PSD95, NR2A, and LRP-1, with elevated levels of caspase-3 and Bcl2 proteins, may reflect or contribute to neuronal and synaptic loss in the amnestic mild cognitive impairment hippocampus
19773279 Observational study of gene-disease association. (HuGE Navigator)
19770581 Data show that EGCG inhibited KIT activity after 4 h treatment, and induced cell death via caspase-dependent pathways.
19770576 Data show that sorafenib initiated lethal apoptotic process through the release of cytochrome c and caspase 3/7 activation.
19759058 Specific cleavage by caspase-7 relies on excluding recognition by caspase-3 and not on increasing binding for caspase-7.
19738422 Data show that the N-t-boc-Daidzein induced apoptosis is characterized by caspase activation, XIAP and AKT degradation.
19730442 results identify caspase-3 activation in endothelial cells as a novel inducer of CTGF release and fibrogenesis
19724907 Mitochondrial-dependent caspase activation pathway is involved in baicalein-induced apoptosis in human hepatoma J5 cells.
19724860 Overexpression of Notch1 in laryngeal carcinoma cell line was associated with upregulation of caspase 3
19723039 Results show that no striking relationship was found in expression patterns of p53, Bcl-2, caspase-3, and Fas.
19715609 Data indicate that caspase activity was not essential for docetaxel-induced cytotoxicity since cell death associated with lysosomal membrane permeabilization still occurred in the presence of caspase inhibitors.
19698994 Suppression of p38 MAPK sensitized T cells to Fas-mediated apoptosis and increased caspase-8 and caspase-3 cleavage
19692467 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
19692168 Observational study of gene-disease association. (HuGE Navigator)
19665028 Data demonstrate the strong inhibition of human initiator and effector caspases 3 and 8 by bovine SERPINA3-1 and A3-3.
19655415 Data show that magnolol inhibited H2O2-induced expressions of caspase-9 and caspase-3 and reduction of Bcl-2/Bax ratio.
19655254 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
19655253 The current study shows that the executioner caspase-3 and -7 have similar conformations for the unliganded active site as well as the inhibitor-bound active site.
19636556 Data show that with SF1126 treatment, caspase 3 and PARP proteins were cleaved, survivin was down-regulated, and inhibition of PI3-kinase was confirmed by reduced phosphorylation of Akt.
19626422 UTP- and thapsigargin-induced caspase-3 and caspase-9 activation and mitochondrial membrane depolarization is dependent on rises in [Ca(2+)](c) in human myeloid HL-60 cells
19625176 Observational study of gene-disease association. (HuGE Navigator)
19610261 mitochondrial respiration is essential for activation of ERK1/2 and caspase-3 in human eosinophils stimulated with H2O2.
19604093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19598027 The positive rates of AIF and caspase-3 in colorectal adenoma were higher than those in normal mucosa. Caspase-3 expression in adenomas was significantly higher than that in carcinoma.
19585117 Data show that oroxylin A enhanced 5-FU-induced apoptosis by elevating the expressions of apoptotic-inducing proteins P53 and cleaved PARP and decreasing the expression of apoptotic-inhibitory proteins COX-2, Bcl-2, and pro-caspase3.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19570417 In pre-eclamptic patients the levels of LOX-1 mRNA in placenta were positively correlated with the the expression of caspase-3 and the plasma concentrations of oxLDL.
19567200 Results demonstrated that the inhibition of spontaneous B cell apoptosis by CpG DNA was correlated to up-regulation of Bcl-xL, IAP and down-regulation of p53 and caspase 3 mediated through PI3K/AKT signaling.
19559790 Caspase-3 is activated by lipopolysaccharide under physiological conditions and suggest that human umbilical vein endothelial cells escape from cell death by rapidly releasing activated caspase-3 into extracellular space.
19553679 vIRF-2 mediates IRF-3 inactivation by a mechanism involving caspase-3.
19550122 Data show that the mDRA-6-induced apoptosis was repressed by 77.9% by Caspase-8 inhibitor ZIF, 54.2% by Caspase-3 inhibitor ZDF, and 8.7% by Caspase-9 inhibitor ZLF, but was not repressed by Caspase-10 inhibitor ZAF.
19549685 Caspase cleavage of Atg4D stimulates GABARAP-L1 processing and triggers mitochondrial targeting and apoptosis.
19544333 Data show that IP6 caused a strong apoptotic death of PC-3 cells together with caspase 3 and PARP cleavage.
19531679 The GG genotype of rs2705901 in the caspase-3 gene was significantly associated with increased cancer risk compared with the CC genotype...
19531679 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19519609 TRAIL, DR5 and caspase-3 overexpression and enhanced Terminal Deoxynucleotidyl Transferase Mediated dUTP Nick End Labeling (TUNEL) positivity were found in chronically bitumen-exposed skin
19513559 Induction of apoptosis in human lung carcinoma cells by the water extract of Panax notoginseng is associated with the activation of caspase-3 through downregulation of Akt.
19458171 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
19453261 Observational study of gene-disease association. (HuGE Navigator)
19414860 Observational study of gene-disease association. (HuGE Navigator)
19404232 Caspase3 is up regulated in the small for gestational age group in comparison to the control group.
19379562 2-methoxyestradiol treatment increased expression of caspase-3 in K562 cells.
19355923 loss of FoxO3a through gene silencing prevents the induction of caspase 3 activity by Abeta(1-42).
19351510 Data show there were significant changes of Bcl-2, caspase-3 mRNA and caspase-3 activity; while no changes of bax was found.
19319745 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
19299722 caspase-3 increases in parallel with the loss of CD28 in long-term cultures of human CD8(+) T lymphocytes
19289465 TRAIL- and troglitazone-induced apoptosis was preceded by a cleavage of beta-catenin, which was complete in a fully apoptotic population, and was mediated by caspases-3 and -8.
19283487 Caspase-3 recognition of various P4 residues in its numerous protein substrates was investigated by crystallography, kinetics, and calculations on model complexes.
19281794 PU.1 protein is cleaved into two fragments of 24 kDa and 16 kDa during apoptosis progression in leukemic cell lines and primary leukemic cells by caspase-3.
19275587 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
19275586 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
19275584 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
19272183 Results show that dihydroartemisinin can inhibit proliferation and induce apoptosis via caspase-3-dependent mitochondrial death pathway in ASTC-a-1 cells.
19270727 RanBP1-interfered cells show an increased apoptotic response to taxol compared to their counterpart with normal or high RanBP1 levels, and this response is caspase-3 dependent.
19269008 Observational study of gene-disease association. (HuGE Navigator)
19266703 peripheral blood mononuclear cells from healthy subjects and from AD patients expressed Bcl-2, Bax, and caspase-3 to about the same extent
19244543 cinobufocini induces apoptosis of A 549 cells, which is associated with the decreasing expression of survivin mRNA and protein, increasing caspase-3 activity of A 549 cells.
19241192 Modulation of effector caspase-3 cleavage determines response of breast and lung tumor cell lines to chemotherapy.
19236754 Gambogic acid induces the apoptosis of Raji cells through DIO-1 upregulation, nuclear translocation, Bcl-xL downregulation and caspase 3 activation.
19223905 p53 stabilisation and caspase-3 activation concur to determine the apoptotic response mediated by Apollon knockdown in breast cancer cells.
19219602 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19204086 UVA-induced caspase-3 cleavage and DNA fragmentation were suppressed by the knockdown of human Myt1 in skin cancer cells.
19200347 A caspase-3 independent mechanism is responsible for tau truncation at aspartate421 in transgenic mouse models.
19178812 The immunohistochemical reaction of eNOS, iNOS and caspase-3 in tonsillar cancer (N = 17), chronic tonsillitis (N = 11) and clinically healthy tonsils (N = 8) was detected.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19159073 Extracellular adenosine induces apoptosis in Caco-2 cells by activating caspase-9 and the downstream effector caspase caspase-3 in association with mitochondrial damage via A(2a) adenosine receptors.
19157506 Cleaved caspase-3 expression was an independent predictor of longer progression-free survival for serous ovarian carcinoma patients with postchemotherapy effusions
19157504 Among the 112 patients with urothelial carcinoma of the upper urinary tract 27 (24.1%)had altered expression of caspase-3
19141860 Observational study of gene-disease association. (HuGE Navigator)
19132366 Taken together, two-photon excitation fluorescence lifetime imaging microscopy and emission spectral imaging analysis were proved to be valuable approaches for monitoring caspase-3 activation inside single living cells.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
19052714 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19046417 These data suggest a mechanism for maintaining NF-kappaB activity in human T cells through the binding of the Caspase-3-generated carboxy-terminal fragment of p65/RelA to IkappaBalpha in order to protect wild-type p65/RelA from IkappaBalpha inhibition.
19043361 results indicate that the apoptosis markers Fas receptor and caspase-3 might play a significant role in glaucoma neuropathy at the stage of absolute glaucoma
19035131 The expressions of LOX-1, caspase-3, and Bax are upregulated in placentas of preeclampsia.
19013323 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
18986328 Desipramine-induced Ca-independent apoptosis in Mg63 human osteosarcoma cells: dependence on P38 mitogen-activated protein kinase-regulated activation of caspase 3.
18946722 Report co-localization of hyperphosphorylated tau and caspases 3/6 in the brainstem of Alzheimer's disease patients.
18844072 Activated caspase-3 in T cell subsets of idiopathic thrombocytopenic purpura patients was notably higher than that in healthy controls.
18838202 Overexpression of FLIP reduced TRAIL and TNF-alpha-induced apoptosis in ML-1 cells. However, while FLIPL completely abrogated apoptosis, FLIPS allowed for BID cleavage and caspase-3 activation.
18829519 genetic variation in CASP3 may contribute to risk of squamous cell carcinoma of the head and neck
18829519 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18821563 Downmodulation of BAG3 protein levels allows caspase-3 activation by HIV-1 infection in human primary microglial cells.
18820371 significant correlations were observed between caspase-3 mRNA expression and the parameters tested were a direct one with both the Bax and a variant of the X-chromosome RBM10 gene, and an inverse one with the angiogenesis-associated CD105 (endoglin) gene
18818379 These data demonstrate for the first time the preferential localization and increase of caspase-3 in the postsynaptic density fractions in Alzheimer's disease and suggest an important role for caspase 3 in synapse degeneration during disease progression.
18814044 Results describe the immunohistochemical distribution of caspase 3, 9 and Bax in intracranial U87 glioblastoma xenografts, and show that xenografts contain cells positive for caspase-3, caspase-9, and Bax.
18768468 Isoquinoline-1,3,4-trione derivatives inactivate caspase-3 by generation of reactive oxygen species
18763039 Caspase-3 independently associates with coronary calcium, aortic wall thickness, and compliance, suggesting a link between apoptosis and atherosclerosis.
18759060 in glioma & glioblastoma multiforme, selective upregulation of miRNA-221 & down-regulation of a miRNA-221 mRNA target encoding BIRC1 were observed; expression of BIRC5 & caspase-3 were found to be significantly up-regulated, particularly in stage IV GBM
18754867 We suggest that caspase-3 may function as an indicator of the prognosis of BL/BLL
18727869 Dimethylformamide can induce apoptosis of cultured adult normal hepatocytes in vitro by reducing expression of Bax and Bcl2 and cleaving casp3.
18723680 Caspase-3 and caspase-7 exhibit differential activity toward multiple substrate proteins, including Bid, XIAP, gelsolin, caspase-6, and cochaperone p23.
18712678 Describe caspase-3 expression in developing pituitary gland.
18708163 hMTH1 plays an important role in protecting cells against H(2)O(2)-induced apoptosis via a Noxa- and caspase-3/7-mediated signaling pathway, thus conferring a survival advantage through the inhibition of oxidative-stress-induced DNA damage
18676680 Observational study of gene-disease association. (HuGE Navigator)
18658137 Caspase-3 activation triggers extracellular cathepsin L release and endorepellin proteolysis.
18652315 shRNA directed against hTERT inhibits cell viability by regulating telomerase activity and PCNA protein expression in NPC cells.
18623086 caspase-3 induces ERK activation through a ceramide-dependant, protease activity-independent mechanism
18586680 identification of O-GlcNAcase as a caspase-3 substrate with a novel caspase-3 cleavage site and provide insight about O-GlcNAcase regulation during apoptosis.
18577580 eIF3k, originally identified as the smallest subunit of eukaryotic translation initiation factor 3 (eIF3) complexes, also localizes to keratin intermediate filaments and physically associates with K18 in epithelial cells.
18561948 Fas+CD8+ T cells preferentially underwent apoptosis and showed high caspase-3 activation in gastric cancer.
18551626 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
18521960 study provides evidence that during T cell proliferation the intracellular caspase inhibitor X-linked inhibitor-of-apoptosis protein (XIAP) interacts with caspases-3/-7, thereby blocking their full activation, substrate cleavage, and cell death
18476631 Expression of Survivin, Caspase-3 and p53 in surgical margin of LSCC may play an important role in the tumorigenesis and development of laryngeal carcinoma.
18473402 The positive expression rates of Fas, caspase-8 and caspase-3 in somatostatin high and moderate expression groups were higher than that in low expression group.
18450750 inhibitor-3 is an in vivo target of caspase-3 and participates in the apoptotic response
18441516 insulin stimulation reversed the camptothecin induced increase of caspase-3 activity
18439040 caspase 3 cleavage of Rad51 resulted in a functional decrease in Rad51 strand exchange activity and that inhibition of caspase 3 activity increased Rad51 protein levels and Rad51 foci
18427836 These results show that the Fas/FasL-system mediated by caspase-3 activation plays a role in Clonorchis sinensis-infected hepatocyte apoptosis.
18415689 The distribution of the bcl-2, bax and caspase-3 proteins was investigated in the cells of developing human spinal ganglia.
18415681 It is concluded that P. aeruginosa can induce apoptosis with an up-regulated expression of Bax and a down-regulated expression of Bcl-2, which resulted in increased levels of cytochrome c release and increased caspase-3 and -9 in human U937 cells.
18384375 SP1-like sequences mediate human CASP3 promoter activation by p73 and cisplatin.
18381704 Observational study of gene-disease association. (HuGE Navigator)
18379198 analysis of how active caspase-3 causes apoptosis
18330265 Quercetin can activate the expression of Caspase-3 and induce the apoptosis of nasopharyngeal carcinoma HEN1 cells.
18300076 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
18298948 We show that human PLD1b and PLD2a contain functional caspase 3 cleavage sites and identify the critical aspartate residues within PLD1b that affect its activation by phorbol esters.
18297401 Western blotting suggests that vinorelbine cleaves caspase-3, -9 and -8 and reduces the amount of mitochondrial cytochrome c.
18296636 IL-32-induced monocyte-to-macrophage differentiation is mediated through nonapoptotic, caspase-3-dependent mechanisms
18266005 The role of multinucleated giant cells may thus be different from epithelioid cells by virtue of higher MPT64, more TGF-beta, and reduced caspase 3 which may contribute towards persistence of infection
18256791 Data show that diallyl sulfide induces apoptosis in human colon cancer cells, and that caspase-3, NF-kappaB, and ERK-2 are involved.
18256758 Sharp inhibition of apoptosis and changes in the levels of cell proliferation in tumor cells were paralleled by decreased expression of peripheral benzodiazepine receptor in patients with squamous cell carcinoma & skin melanoma.
18227733 Survivin and caspase-3 expression correlate with poor prognostic parameters (higher histologic grade and high proliferation), but not with outcome, in breast carcinoma patients.
18211414 The low frequency of apoptotic phenomena (caspase-3 and Bax) in epithelial cells of oral lichen planus may create a favourable substrate for malignant transformation.
18209072 Triggering of cytosolic RNA recognition pathway with poly(I:C) transfection or influenza A virus infection resulted in caspase-1- and -3-mediated proteolytic processing of pro-IL-18 and secretion of biologically active IL-18.
18171980 The basal caspase activity is accompanied by a constant cleavage of the motility-associated gelsolin protein, which may contribute to the caspase-mediated promotion of migration and invasiveness in glioblastoma cells
18164959 caspase-3 activation by RSVL is required for PARP degradation and induction of apoptosis
18155731 The experiments revealed that N induces the intrinsic apoptotic pathway, resulting in processing of N at residues 400 and 403 by caspase-6 and/or caspase-3.
18155705 Activation of caspase-3 by hydrogen peroxide and progesterone suggest mitochondrial apoptosis is dependent on calcium signaling.
18092356 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
18088367 Increased social interaction in mice deficient of the striatal medium spiny neuron-specific phosphodiesterase 10A2.
18086147 Melatonin maintains mitochondrial membrane potential and attenuates activation of initiator (casp-9) and effector caspases (casp-3/casp-7) and PARP in UVR-exposed HaCaT keratinocytes
18083346 HSP105 appears to chaperone the responses to endoplasmic reticulum (ER) stress through its interactions with GRP78 and GSK3, and without HSP105 cell death following ER stress proceeds by a non-caspase-3-dependent process.
18074388 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
18060501 For the first time our data demonstrate that CSN-mediated deneddylation can be regulated by active Casp3 and that the CSN executes a specific function during the apoptotic process.
18058802 Single nucleotide polymorphisms in the Caspase-3 gene is associated with lung cancer
18058802 Observational study of gene-disease association. (HuGE Navigator)
18055116 caspase-3 could be involved in recruitment of ischemic brain tissue being a marker of infarct growth.
18054197 Enteropathogenic Escherichia coli induced apoptosis in T84 intestinal epithelial cells via induction of caspases-3, -8, and -9.
18047842 apoE expression modulates capase-3 activity, but this has no significant impact on sensitivity to apoptosis and only a moderate impact on basal cholesterol efflux.
18000616 release of caspase 3-containing microparticles may contribute to endothelial cell survival
17989718 constitutively and overexpressed AML1-ETO protein was cleaved to four fragments of 70, 49, 40 and 25 kDa by activated caspase-3 during apoptosis induction by extrinsic mitochondrial and death receptor signaling pathways.
17983802 Two novel homozygously deleted genes in hepatocellular carcinomas are caspase 3 and CHES1.
17981569 bcl2 and Caspase-3 have roles in Shikonin analogue (SA) 93/637 induced apoptosis of human U937 cells
17978580 These data indicate that cytosolic PDI is a substrate of caspase-3 and -7, and that it has an anti-apoptotic action.
17967742 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
17950632 Results describe the role of carbohydrate moiety of bleomycin-A2 in caspase-3 activation and internucleosomal chromatin fragmentation in apoptosis of laryngeal carcinoma cells.
17936584 Gastrins activate members of Rho family G proteins which in turn regulate different proteins of the Bcl-2 family leading to changes in caspase 3 activity.
17928446 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
17908973 Caspase-3 may have a role in local recurrence in rectal cancer
17880920 These findings suggest that caspase-7 facilitates the execution of apoptosis through down-regulation of the 26S proteasome, which regulates the turnover of proteins involved in the apoptotic process.
17805550 Report caspase-3 activity, response to chemotherapy and clinical outcome in patients with colon cancer.
17724022 XIAP homotrimerizes via its C-terminal Ring domain, making its inhibitory activity toward caspase-3 more susceptible to Smac.
17721932 S100A6 might be involved in the processing of apoptosis by modulating the transcriptional regulation of caspase-3.
17698513 Thimerosal caused Ca2+-independent apoptosis of gastric cancer cells via phosphorylation of p38 MAPK and caspase-3 activation.
17689858 caspase-3 is a key regulator of apoptosis in response to combined genistein and TRAIL in human gastric adenocarcinoma AGS cells through the activation of DR5 and mitochondrial dysfunction
17653867 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
17645689 demonstrate the cellular mechanisms of neuronal cell degeneration induced via c-Jun-N-terminal kinases and caspase-dependent signaling
17616526 RbAp48-mediated transformation of HPV16 is probably because of the regulation by RbAp48 of tumor suppressors retinoblastoma and p53, apoptosis-related enzymes caspase-3 and caspase-8, E6, E7, cyclin D1 (CCND1), and c-MYC.
17606900 A specific transnitrosation reaction between procaspase-3 and thioredoxin-1 (Trx) occurs in cultured human T cells and prevents apoptosis.
17606719 cleaved caspase-3 is an activated form of caspase-3 that has a role in preventing progression of gliomas
17597071 caspase-3 prodomain binding to heat shock protein 27 regulates monocyte apoptosis by inhibiting caspase-3 proteolytic activation
17559062 Caspase 3 regulated the biochemical, morphological, and functional changes in cells undergoing staurosporine-induced apoptosis. Full-length Dsg2 was processed to a 70-kDa fragment which was released into the cytosol.
17544405 Akt1 is cleaved in vitro at the caspase-3 consensus site DQDD(456).
17534194 Observational study of gene-disease association. (HuGE Navigator)
17525639 CASP3 expression was higher in the helicobacter pylori infection (HP+) group, HP+ with intestinal metaplasia, and HP+ with dysplasia groups.
17505517 Survivin-DeltaEx3 plays a key role in the inhibition of caspase-3 activity.
17498346 The activity of Caspase-3 increased significantly in MMT-induced apoptosis in PC-3M cells.
17495975 EXEL-0862 induced apoptotic death in EOL-1 cells and imatinib-resistant T674I FIP1L1-PDGFR-alpha-expressing cells, and resulted in significant downregulation of the antiapoptotic protein Mcl-1 through a caspase-3 dependent mechanism.
17488272 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
17462862 NF-kappa-B inhibition enhances CASP3 degradation of Akt1 and apoptosis in response to campogthecin.
17437405 Results demonstrate that cleavage by caspase 3 does not activate caspase 9, but enhances apoptosis by alleviating XIAP inhibition of the apical caspase.
17436592 A 3-fold increase in caspase-3 activity was observed in cells treated with TAC-101 colon cancer cells in comparison to the control cells.
17430778 An 8.94-fold and 6.73-fold increase in expression of caspase-3mRNA in intracranial aneurysm and AAA, respectively, were obtained relative to the normal vessels.
17413988 In this test set, cyclooxygenase 2 and Caspase 3 seem to be immunohistochemical markers with prognostic significance for vulva cancer.
17412564 Cystatin A suppresses UVB-induced apoptosis of keratinocytes by the inhibition of caspase 3 activation.
17379327 caspases-3 and caspase-9 play novel roles in transcription by regulating polycomb protein function through direct cleaving of Ring1B.
17364171 Comparing SIDS to non-SIDS cases, increased active caspase-3 expression was restricted to four nuclei in the caudal pons and two nuclei in the rostral medulla.
17324936 calcineurin B potentiates the activation of procaspase-3 by accelerating its proteolytic maturation
17321792 Caspase 3 was found to be activated by elaidic acid and palmitic acid.
17301822 Caspase-3 and the p38alpha MAP kinase were activated during TIMP-1-induced UT-7 cells erythroid differentiation.
17272816 In this review, reversible glutathiolation of procaspase-3 by glutaredoxin provides further mechanistic insight into the role of reactive oxygen species in TNF-alpha-induced apoptosis.
17245643 While polyploid, mature megakaryocytes from healthy subjects or myelodysplastic syndromes patients manifested caspase-3 activation during terminal differentiation, freshly isolated, immature MK from MDS died without caspase-3 activation
17235653 The expression of Caspase 3 in peripheral blood mononuclear cells was significantly increased in SLE patients.
17219053 Data show that caspase-3 antisense oligodeoxynucleotides inhibit apoptosis in gamma-irradiated human leukemia HL-60 cells.(
17217622 Pro-caspase 3 appears to be a substrate of SAG/ROC-(beta-TCRP) E3 ubiquitin ligase, which protects cells from apoptosis by reducing the basal level of pro-caspase-3.
17198755 Adult stem cell injections into blastocysts is influenced by apoptosis as shown by high caspase-3 activity.
17172814 Human tumor xenograft in nude mice is suppressed significantly by the treatment with a hTERT/re-Caspase-3 system.
17167422 in erythroid precursors undergoing terminal differentiation, Hsp70 prevents active caspase-3 from cleaving GATA-1 and inducing apoptosis
17143787 Results discuss caspase-3 immunohistochemical expression as a marker of apoptosis, increased grade and early recurrence in intracranial meningiomas.
17141888 The role of high gammaGT activity in HepG2 cells can be connected with production of reactive oxygen species and with S-thiolation with Cys and Cys-Gly that can influence activity of caspase 3.
17140287 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
17130234 PTP-PEST actively contributes to the cellular apoptotic response and reveal the importance of caspases as regulators of PTPs in apoptosis.
17124493 These data demonstrate that huntingtin inhibits caspase-3 activity.
17123522 expression of FasL is upregulated in testes of patients with Sertoli cell-only syndrome & maturation arrest, suggesting that it may be associated with apoptotic elimination or altered maturation of Fas-expressing germ cells by activation of caspase-3.
17121821 p53-dependent staurosporine-induced caspase-3 activation is affected by the C-terminal products of cellular prion protein processing, C1 and C2
17118559 Interaction of Ramos cells with immobilized alpha2,6-linked sialic acid suppresses cas[ase-3 activity and inhibits Igm-induced apoptosis.
17114647 Taken together, our results indicate that IL-4 inhibits caspase activity during the initial stages of human Th2 cell differentiation by regulating expression of several key players in the Fas-induced pathway.
17080552 Observations suggest that PB-induced apoptosis occurs through a caspase-dependent pathway and detains the cell cycle in the G2/M phase.
17071630 Observational study of gene-disease association. (HuGE Navigator)
17071630 Single nucleotide polymorphismsin caspase 3 is associated with non-Hodgkin lymphoma
17065568 Cell death in the penumbra of subacute infarcts is partially caspase-3 independent and may be attributed to nitric oxide.
17038954 Immunoreactivities indicating single-stranded DNA and cleaved caspase-3 were higher in moyamoya disease than in controls and were located in smooth muscle cells of media.
17023557 Collectively, these data suggest that cathepsin D activation of caspase 3/7 may be required for inducing one of the death pathways elicited by E. coli.
17013758 These data indicate that, in addition to its function as an effector caspase, caspase-3 plays an important role in maximizing the activation of apical caspases and crosstalk between the two major apoptotic pathways.
17013756 This study demonstrates FHOD1 is cleaved by caspase-3 at the SVPD(616) site during apoptosis and the C-terminal FHOD1 cleavage product has the ability to inhibit RNA polymerase I transcription.
16983089 ROCK-1-dependent caspase-3 activation was coupled with the activation of PTEN and the subsequent inhibition of protein kinase B (Akt) activity, all of which was attenuated by siRNA directed against ROCK-1 expression.
16977583 CASP3 was overexpressed in 40.8% of the 210 invasive ductal breast carcinomas studied
16955788 Results indicate that caspase-3 mRNA antisense oligodeoxynucleotides prevent HL-60 cells from apoptosis induced by gamma-radiation,and reduce expression of caspase-3 and its mRNA.
16949642 Active caspase 3-positive Reed-Sternberg cells were detected in 47 of 70 cases.
16948902 Fas-FasL signal transduction pathway plays an important role in the induction of T cell apoptosis.
16935258 peroxynitrite-mediated inhibition of human caspase-3 is impaired by CO2
16931214 Activated caspase-3-positive cells were present in glomeruli of 88.2% of lupus nephritis cases, observed in the glomerular tuft and cellular and fibrocellular crescents
16897667 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
16894574 These data imply that confluent cells undergo spontaneous cell death mediated by cathepsin B; Lipopolysaccharides may accelerate this caspase-independent cell death through release of mitochondrial contents and reactive oxygen species.
16884727 HDL prevents endothelial progenitor cell (EPC)apoptosis through inhibition of caspase-3 activity suggesting a possible mechanism for its positive effects on circulating EPC numbers
16882668 Caspase-3-dependent activation of calcium-independent phospholipase A2 enhances cell migration in non-apoptotic ovarian cancer cells
16835231 Data show that decorin protein core inhibits tumor xenograft growth and metabolism by hindering epidermal growth factor receptor function and triggering apoptosis via caspase-3 activation.
16808908 Expression level of intracellular activated caspase-3 in peripheral T cell subsets increases in patients with active systemic lupus erythematosus (SLE), compared to patients with inactive SLE and healthy controls.
16802364 AECA subsets in the sera of patients with systemic sclerosis (SSc) and diffuse SSc induce patterns of human dermal endothelial cells gene expression in the setting of apoptosis with increased caspase 3 activity and reexpression of fibrillin 1.
16791842 Thus, early activation of caspase-3 seems to be a non-apoptotic event required for cellular function.
16787777 The atomic resolution (1.06 Angstroms) crystal structure of the caspase-3 reveals the structural basis for substrate selectivity in the S4 pocket.
16781734 Crystal structures were determined of caspase-3 complexes with the substrate analogs at resolutions of 1.7 A to 2.3 A.
16716256 caspase-3 and caspase-9 activation has critical roles in hypoxia/reoxygenation induced apoptosis
16689860 caspase-3 cleavage in the spinous layer of the epidermis is a pathologic event contributing to spongiosis formation in acute atopic dermatitis
16651613 SUMOylation and activation of ataxia-telangiectasia-mutated protein, PKCdelta, caspase-3, and nuclear factor kappaB signaling pathways modulate salivary adaptive responses to stress in cells exposed to either 1% O(2) or DFO.
16567804 caspase-3 cleavage of EAAT2 is one mechanism responsible for the impairment of glutamate uptake in mutant SOD1-linked amyotrophic lateral sclerosis
16530191 Protein-protein interaction of NMTs revealed that m-calpain interacts with NMT1 while caspase-3 interacts with NMT2.
16530181 These results suggest that caspases, including caspase 3, can act as substrates for non-caspase proteases in cells primed for necrosis induction.
16529748 CAD is downregulated at the mRNA and protein level during the erythroid differentiation in TF-1 cells.
16526059 170-kDa P-gp has been reported to counteract apoptosis, its cleavage may be a mechanism aimed at blocking an important cell survival component
16520893 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
16516911 Asymmetric dimethylarginine induces apoptosis of endothelial cell via elevation of intracellular oxidant production, which involves p38 MAPK/caspase-3-dependent signaling pathway.
16511342 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
16505307 Blood values increased in untreated Parkinson disease patientes.
16498457 These results demonstrate that SSRP1 degradation during apoptosis is a two-step process coupling caspase cleavage and ubiquitin-dependent proteolysis.
16480911 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
16463650 Caspase-3 was expressed increasingly and activated in HCMV-infected cells.
16455648 NFATc2 activity is regulated by caspase-3
16382148 tTGase is a new type of caspase 3 inhibitor in THG-mediated apoptosis.
16338743 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
16337360 These results provide evidence for a novel type 1 IFN-mediated pathway that regulates apoptosis of T cells through a mitochondrial-dependent and caspase-dependent and independent pathway.
16330530 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
16320828 Apoptosis marker activated caspase-3 was analysed by immunohistochemistry, during the production of collagen type II, the adhesion and signal transduction receptor beta1-integrin.
16300929 Thrombin is able to induce activation of caspases 3 and 9 in human platelets and significantly increases the amount in the cytoskeleton of the active forms of both caspases and the procaspases 3 and 9.
16286477 desmoglein 1 is a novel caspase-3 target that regulates apoptosis in keratinocytes
16242324 caspase-3, -8, and -9 activity is enhanced by safrole oxidase in lung cancer cells
16213496 Caspase 3 activation is a prominent feature in periodontitis-associated tissue injury.
16203739 the prodomain acts as an intramolecular chaperone during assembly of the (pro)caspase-3 subunits and increases the efficiency of formation of the native conformation
16179347 involvement of Fas/caspase 8/caspase 3-dependent signaling in an enucleated cell leading to PS externalization, a central feature of erythrophagocytosis and erythrocyte biology
16121124 cleaved caspase-3 positive cells was found in temporal lobe epilepsy sections but not controls; nuclear localization of apoptosis-inducing factor was limited and restricted to cells that were negative for cleaved caspase-3
16120388 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
16111829 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
16083554 Data show that Caspase-3 was involved in the apoptosis of glomeruli and renal tubuli of lupus nephritis.
16080782 The characteristics of the fragment of hPMCA4b produced by caspase-3 are reported.
16009347 These findings provide biological evidence showing that (+)-alpha-tocopherol can amplify the apoptotic response by up-regulating the expression of pro-caspase-3.
15996160 Caspase 3 plays a important role in apoptotic process of mesothelioma cells.
15935070 The antiapoptotic property of Hualpha-Syn in neuronal cell lines is associated with the attenuation of caspase-3 activity without affecting the caspase-9 activity or the levels of cleaved, active caspase-3.
15869582 caspase 3 exists in microparticles from endothelial cells and may be associated with caspase 3 activation unrelated to apoptosis
15848173 calcium could favour a necrotic mechanism by inducing the generation of a form of caspase 3 insensitive to mitochondrial activation
15843892 procaspase-2S-mediated anti-apoptotic effects are associated with inhibition of the processing and activation of procaspase-3 in VP-16-treated cells
15803189 Absence of active caspase 3-positive nasopharyngeal carcinoma predicts rapid fatal outcome.
15767427 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
15748808 Stx1 and LPS trigger DNA fragmentation and caspase-3 activation, as evidenced by the cleavage of poly(ADP-ribose) polymerase (PARP).
15748158 Caspase 3 activation associated with cellular prion is closely related to its ability to undergo endocytosis. This is, to our knowledge, the first direct description of an endocytosis-dependent PrP(c)-associated function.
15725353 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
15716280 PKCdelta-dependent phosphorylation of caspase-3 is involved in the regulation of monocyte life span
15705385 Caspase-3 dependent apoptosis occurs in human granulosa cells and activates when follicles begin to leave the resting pool.
15670787 Taken together, our data suggested that the JNK/c-Jun signaling cascade plays a crucial role in Cd-induced neuronal cell apoptosis and provides a molecular linkage between oxidative stress and neuronal apoptosis.
15657356 The increased ratio of Bax/Bcl-2 proteins after Epigallocatechin-3-gallate may lead to activation of caxpaxe-3, leading to apoptosis.
15657349 Gossypol induced complete cytochrome c release from mitochondria amd increased caspases-3 and -9 activity in large cell lymphoma cells.
15638357 Expression correlates with intensity of apoptosis in colorectal adenocarcinoma.
15637055 removal of N-terminal domains of Bid by caspase-8 and Mcl-1 by caspase-3 enables the maximal mitochondrial perturbation that potentiates TRAIL-induced apoptosis
15617521 results suggest that Anaplasma phagocytophilum inhibits human neutrophil apoptosis via transcriptional upregulation of bfl-1 and inhibition of mitochondria-mediated activation of caspase 3
15599395 caspase-3 is crucial for the differentiation of bone marrow stromal stem cells by influencing TGF-beta/Smad2 pathway and cell cycle progression
15578977 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
15569692 results suggest that active caspase-3 is translocated in association with a substrate-like protein(s) from the cytoplasm into the nucleus during progression through apoptosis
15569672 the early and temporary activation of PP2A in neutrophils impaired not only the p38 MAPK-mediated inhibition of caspase 3 but also restored the activity to caspase 3 that had already been phosphorylated and thereby inactivated
15569669 granzyme B targets a highly restricted range of substrates and orchestrates cellular demolition largely through activation of caspase-3
15564512 required for Sars virus 7a protein induction of apoptosis in cell lines from different organs
15505416 CASP3 was expressed in the same tissues as its murine counterpart.
15473998 These data suggest that increased proneness to caspase activation in lymphocytes could reflect an ongoing systemic response in neurodegenerative disease with pathogenetic implications.
15375594 hypoxia caused epithelial cell death induced by caspase-3-like activity-dependent apoptosis
15280469 induced and utilized by human Astrovirus Yuc8 to promote processing of the capsid precursor and dissemination of the viral particles in CAC0-2 cells.
15254227 BAP31 and caspase 3 are cleaved in a process involving capsase 8 in the mitochondrial membrane during apoptosis
15246206 Neutrophils isolated from cirrhosis patients exhibited a decreased viability and a marked accelerated apoptosis and significantly higher caspase-3 activity.
15241180 results suggest that matrix metalloproteinase-9 and matrix metalloproteinase-2 contribute to caspase-mediated brain endothelial cell death after hypoxia-reoxygenation by disrupting cell-matrix interactions and homeostatic integrin signaling
15220451 required for Parvovirus B19 virus-induced apoptosis in primary hepatocytes and hepatocellular carcinoma cell line HepG2
15205454 caspase-8 and -3 have roles in human mast cell apoptosis induction by Pseudomonas aeruginosa exotoxin A
15204919 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
15187159 granule pools of Zn may be distinct from those regulating activation of procaspase-3 and NF-kappaB.
15179054 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
15156398 Overexpression of antiapoptotic proteins Bcl-2 and Bcl-X(L) and down-regulation of caspase-3 activity may be associated with cisplatin resistance in human ovarian cancer.
15153940 mice overexpressing human caspase 3 are essentially normal, however, they have increased susceptibility to degenerative insults
15098015 Caspase-3 is frequently overexpressed in hepatocellular carcinomas and is associated with high serum levels of alpha-fetoprotein.
15041704 Transfected caspase-3 is involved in the reduction of Akt level, and its involvement is mediated through caspase-9 activation.
15033815 glc-oxLDL increases TUNEL positivity and caspase-3 activation of human coronary smooth muscle cells
15033720 Dispensable for the execution of apoptosis in a metastatic melanoma cell line.
15015772 Synthetic activation of inducible caspase-3, but not of caspase-8, resulted in apoptosis in glioma cell lines.
15014070 Mcl-1L degradation by either GrB or caspase-3 interferes with Bim sequestration by Mcl-1L
14993250 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
14991812 Caspase-3 activation in human disease can play a prominent role in localized cellular degenerative processes without causing nuclear or cell death.
14982947 IL-15 does not increase IL-1alpha or IL-1beta production but induces IL-1Ra release, increases myeloid cell differentiation factor-1 stability, decreases the activity of caspase-3 and caspase-8, resulting in an inhibition of vimentin cleavage
14976035 activated in normal erythropoiesis and in erythroblasts in culture
14971566 IFN-gamma-activated monocytes may induce reactive oxygen metabolites in retinal pigment epithelial(RPE) cells through cell-to-cell contact and promote HRPE cell apoptosis via caspase-3 activation.
14970175 p38-MAPK can directly phosphorylate and inhibit the activities of caspase-8 and caspase-3 and thereby hinder neutrophil apoptosis, and, in so doing, regulate the inflammatory response.
14960581 Evidence indicates that casp3 activated by ricin acts on BAT3 at the caspase cleavage site, DEQD(1001) to release a C-terminal fragment designated CTF-131, which induces phosphatidylserine exposure, cell rounding, and chromatin condensation as ricin does
14764700 In Jurkat cells caspase-3 is a component of the death-inducing signaling complex that colocalizes in lipid rafts with caspase-8, where caspase-3 activity is required for complete caspase-8 activation following Fas cross-linking.
14710359 IGF-I activates specific apoptotic pathways (Caspase-3 activation, Annexin-V binding and DNA degradation in an osteosarcoma cell line.
14684629 Caspase-3 is activated in oxidized low-density lipoprotein (ox-LDL) induces apoptosis in endothelial cells.
14678329 activation of caspase-3 by the Dot/Icm virulence system of Legionella pneumophila is essential for halting biogenesis of the L. pneumophila-containing phagosome through the endosomal/lysosomal pathway
14674699 caspase-3 activation, mitochondrial respiratory function and cytochrome c release have roles in induction of apoptosis by ceramides
14657946 Doxorubicin-induced cell death of ALK-positive anaplastic large-cell lymphoma (ALCL) cells involves CASP3 activation. CASP3 activation correlates with ALK expression in ALCL tumors.
14623896 apoptosis was preceded by proteolytic cleavage of caspases 2, 3, and 7, and wild type STAT1 also induced cleavage of caspase 7
14612448 the cascade of pro-apoptotic events leading to Bax, mitochondria, and caspase-3 activation are regulated by calpastatin and calpain-1
14572611 Inhibition of the Src-family tyrosine kinases activity by PP2 and of caspase-3 by Z-DEVD-FMK reverses apoptosis
14570914 Caspase 3 has a role in proteolysis of the N-terminal cytoplasmic domain of the human erythroid anion exchanger 1 (band 3)
14555204 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
12897143 Caspase 3-mediated inactivation of rac GTPases promotes drug-induced apoptosis in human lymphoma cells
12874324 Caspase 1 involvement in monocyte lysis induced by Actinobacillus actinomycetemcomitans leukotoxin.
12867600 Data suggest that increased intrathecal release of Fas, but not FasL or caspase 3, in the cerebrospinal fluid of infants with hydrocephalus may serve as an indicator of brain injury from progressive ventricular dilatation.
12854132 Chemical substances derived from the primary foci and metastatic microenvironment can inhibit the growth of metastatic cells by enhancing Caspase-3 expression and diminishing FasL expression in gastric cancer.
12833566 The crystal structure of the binding site of caspase-3 reveals critical side chain movements in a hydrophobic pocket. The positions of these side chains may have implications for the directed design of inhibitors of caspase-3 or caspase-7.
12824190 In Kennedy syndrome, phosphorylation of the polyglutamine-expanded form of androgen receptor regulates its cleavage by caspase-3 and enhances cell death.
12809603 Apoptotic cells secrete chemotactic factors that stimulate the attraction of monocytic cells and primary macrophages. The activation of caspase-3 in the apoptotic cell was found to be required for the release of these chemotactic factors.
12804035 MCF-7 tumor cells are deficient in CASP3 and instead have TNF-alpha-induced apoptosis
12792782 caspase 3 has a role in cell death through apoptosis induced by ursolic acid
12788938 existence of a regulatory mechanism of protein stability and PTEN-protein interactions during apoptosis, executed by caspase-3 in a PTEN phosphorylation-regulated manner.
12788227 CASP3 is activated in the oxidative stress-induced apoptosis in tendon fibroblasts in vitro.
12750404 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
12750393 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
12707329 Caspase 3-mediated cell death is central to the biological control of antigen-independent expansion of recent thymic emigrants from human cord blood.
12700660 Caspase-3 mediates a mitochondrial amplification loop that is required for the optimal release of cytochrome c, mitochondrial permeability shift transition, & cell death during apoptosis induced by treatment with the microtubule-damaging agent paclitaxel.
12700630 the caspase 3 apoptosis program is not required for anti-inflammatory clearance by human macrophages
12686427 activated by coxsackievirus B3 (CVB3) infections and occurred in cells expressing full length CAR
12677451 caspase-3 as a key effector of neuronal apoptosis in pneumococcal meningitis.
12643601 We conclude that the changes in the level of caspase-3 and survivin play an important role in the transformation from normal gastric mucosa to gastric cancer.
12621124 in neutrophils, functional expression of caspase-3 in neutrophils may be regulated during ontogeny.
12611892 caspase-3-mediated proteolysis of FAK, an anti-apoptotic protein, is regulated by hsp72
12606589 Data report that human oocytes and fragmenting preimplantation embryos possess transcripts encoding Harakiri and caspase-3.
12605885 caspase-3 was upregulated in a region-specific manner with marked activation in the selectively vulnerable hippocampal after cerebral ischemia
12598529 one or more distinct cellular mechanisms regulate Bid cleavage by caspases 8 and 3 in situ.
12581734 caspase-3 is essential for efficient induction of apoptosis by staurosporine, but not for mitochondrial steps that occur earlier in the pathway
12579342 CASP3 induced by H202 was completely blocked by Z-VAD-fmk.
12576443 mRNA and protein expression of this enzyme are examined in breast cancer to determine level of apoptosis.
12576296 induction of ceramide accumulation by various triggers of ceramide generation triggered the activation of caspase-3.
12566444 Presentation of nitric oxide regulates monocyte survival through effects on this enzyme and caspase-9 activation.
12515825 caspase 3 has a role in damaging mitochondrial function and generating reactive oxygen species after activation by cytochrome c
12511568 ceramide increases oxidative damage by inhibition of ROS scavenging ability through caspase-3-dependent proteolysis of catalase
12483536 determination of levels of caspase-3 expression in breast tumor samples and to determine whether alterations in its expression can affect their ability to undergo apoptosis
12444137 IFN-gamma-mediated caspase-3 activation and C. burnetii killing depend on the expression of membrane TNF.
12404116 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
12397210 A significant positive correlation between in-situ active caspase-3 in the sperm midpiece and DNA fragmentation was observed in the low motility fractions of patients.
12393901 caspase 3 activation and apoptosis are blocked by LIGHT protein in hepatocytes
12390838 The apoptosis resistance of mdr cells is not related to the abnormality of CPP32 but the upstream of caspase, the fact of which indicates promising prospect of the research on reversion of mdr cells using CPP32 as target.
12297281 caspase 3-independent function of Bak in the TNF-alpha-induced apoptotic pathway
12228224 Data show that endoplasmic reticulum stress induced by thapsigargin not only activated the apoptosis effector caspase-3 but also caused a large and prolonged increase in the activity of glycogen synthase kinase-3beta.
12210761 Role of nuclear PKC delta in mediating caspase-3-upregulation in Jurkat T leukemic cells exposed to ionizing radiation
12190962 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
12181128 Hypoxia-induced cleavage of caspase-3 and DFF45/ICAD in human failed cardiomyocytes.
12169388 Both oleandrin and radiation share a caspase-3 dependent mechanism of apoptosis in the PC-3 human prostate cacncer cell line.
12151338 caspase 3 cleaves CDC6 during apoptosis, which prevents wounded cell from replicating and facilitates death
12145703 Pro-CASP3 moved to the the mitochondria of U937 cells during TPA-induced differentiation.
12095993 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
12080079 Selective inhibition of dipeptidyl peptidase I, not caspases, prevents the partial processing of procaspase-3 in CD3-activated human CD8(+) T lymphocytes
12070657 Caspase-cleaved amyloid precursor protein and activated caspase-3 are co-localized in the granules of granulovacuolar degeneration in Alzheimer's disease and Down's syndrome brain.
12070005 High numbers of active caspase 3-positive Reed-Sternberg cells in pretreatment biopsy specimens of patients with Hodgkin disease predict favorable clinical outcome.
12055227 The significant expression of caspase-3 that occurs in monocytes during serum-deprived induction of apoptosis can be down-regulated to baseline levels by addition of platelets.
12044963 Identification of high caspase-3 mRNA expression as a unique signature profile for extremely old individuals
12036886 Expression levels of apoptosis-related proteins caspase 3, Bcl-2, and PI9 predict clinical outcome in anaplastic large cell lymphoma.
12032677 results suggest that IGF-1/PI-3 kinase inhibited C2-ceramide-induced apoptosis due to relieving oxidative damage, which resulted from the inhibition of catalase by activated caspase-3
12019321 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
12004072 translation of some IRES-containing mRNAs is regulated by proteolytic cleavage of PTB during apoptosis
11992386 Clinical significance of caspase-3 expression in pathologic-stage I, nonsmall-cell lung cancer
11989976 These data suggest that D4-GDI of Rho family GTPase may be regulated during apoptosis through the caspase-3 mediated cleavage of the GDI protein.
11981455 investigation of molecular mechanism of MPO-mediated apoptosis and caspase-3 activation
11972398 caspase 3-mediated focal adhesion kinase processing in human ovarian cancer cells: possible regulation by X-linked inhibitor of apoptosis protein
11960384 Activation of caspase-3 and cleavage of Rb are associated with p16-mediated apoptosis in human non-small cell lung cancer cells.
11866986 caspase-3 may participate in the regulation mechanism of lymphoma cel apoptosis.
11787859 Enzyme activation of caspase-3 was observed in apoptosis of K562 human cell line.
11696595 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
11509621 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
11462036 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
11437602 A soluble proform of caspase 3 containing a fortuitous mutation (W206R) is inactive when incubated with recombinant human caspase 8 and therefore can serve as a useful reagent to test the efficacy of caspase 8 inhibitors.
11177389 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
11141237 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
11123279 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
10942389 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
10799874 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
10708425 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
10704341 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
10602513 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
10438581 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
10430052 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
9878167 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia
9548463 HIV-1 clade B and C Tat induce cleavage of both PARP and CASP3 in primary glia

AA Sequence

MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVD      1 - 70
AANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKIT     71 - 140
NFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSK    141 - 210
DGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH       211 - 277
//

Text Mined References (889)

PMID Year Title
26978233 [Impact of preoperative drug therapy on the expression of apoptosis markers in colorectal liver metastases].
26921582 2016 Caspase-dependent cleavage regulates protein levels of Epstein-Barr virus-derived latent membrane protein 1.