Property Summary

NCBI Gene PubMed Count 134
PubMed Score 416.44
PubTator Score 296.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
gastric cancer 1.500 2.9e-02
pancreatic cancer 1.700 1.8e-02
glioblastoma multiforme 1.400 6.2e-22
oligodendroglioma 1.100 4.3e-13
osteosarcoma -3.982 1.1e-12
group 3 medulloblastoma 2.600 6.2e-06
medulloblastoma, large-cell 1.200 1.1e-03
primitive neuroectodermal tumor 1.500 1.0e-04
juvenile dermatomyositis 1.218 5.5e-15
adrenocortical carcinoma 1.245 1.8e-07
primary pancreatic ductal adenocarcinoma 1.093 1.1e-02
intraductal papillary-mucinous carcinoma... 1.100 3.4e-02
lung cancer 2.000 1.1e-04
Breast cancer 2.400 3.9e-02
pediatric high grade glioma 1.300 2.8e-05
atypical teratoid/rhabdoid tumor 1.100 3.5e-05
pancreatic carcinoma 1.700 1.8e-02
ovarian cancer 1.500 6.8e-05

Gene RIF (92)

PMID Text
26962687 These findings indicate that miR-125a-5p decreases after HOTAIR knockdown to promote cancer cell apoptosis by releasing caspase 2.
25330190 We have also demonstrated that these correlations are tissue specific being reduced (CASP9 and CASP10) or different (CASP2) in the liver
25301067 these studies elucidate a Caspase-2-p53 signaling network that impacts lung tumorigenesis and chemotherapy response in vivo.
25151963 the initiator caspase-2 is required for robust death of ovarian cancer cells induced by FASN inhibitors
25114039 Authors have demonstrated in vitro and in vivo that loss of function of caspase-2 allows to escape oncogenic stress induced senescence.
25010987 HuR sensitizes adenocarcinoma cells to the intrinsic apoptotic pathway by upregulating the translation of caspase-2.
24727569 axon regeneration promoted by suppression of CASP2 and CASP6 is CNTF-dependent and mediated through the JAK/STAT signalling pathway
24321384 Our results reveal a novel mechanism of caspase-2 pre-mRNA splicing.
24292555 Data strongly argue against a critical role for caspase-2 in ER-stress-induced apoptosis.
23568547 MiR-708 may act as an oncogene and induce the carcinogenicity of bladder cancer by down-regulating Caspase-2 level.
23553630 caspase-2 has a role as an initiator caspase in lipoapoptosis
23469978 The role of caspase-2 isoforms in the progression of breast cancer may considerably differ between pre- and post-chemotherapy patients.
23404198 TRIM16 can promote apoptosis by directly modulating caspase-2 activity in cancer cells.
23042294 IRE1alpha regulates translation of a proapoptotic protein, Caspase-2, through terminating microRNA biogenesis, and noncoding RNAs are part of the ER stress response
22825847 activated human caspase-2 shares remarkably overlapping protease specificity with the prototype apoptotic executioner caspases-3 and -7, suggesting that caspase-2 could function as a proapoptotic caspase once released from the activating complex.
22531785 These results revealed a thus far unknown, obligatory role for caspase-2 as an initiator caspase during pore-forming toxins -mediated apoptosis.
22486813 Data indicate induction of caspase-2 by sorting nexin 5 (SNX5) in papillary thyroid carcinoma
22396545 Tumor-suppressing function of caspase-2 requires catalytic site Cys-320 and site Ser-139 in mice.
22201672 TAp73alpha represses caspase-2 enzymatic activity and by this means reduce caspase-2 induced Bax activation, loss of mitochondrial transmembrane potential and resulting apoptosis in small cell lung carcinoma cells.
22174370 Findings suggest that XPC enhances DNA damage-induced apoptosis through inhibition of caspase-2 (casp-2S) transcription.
22077397 Studies indicate that DNA damage may trigger caspase 2 activation.
22002103 caspase-2 acts upstream of caspase-3 and that caspase-2 functions in response to DNA damage in both PhSe-T- and MeSe-T-induced apoptosis.
21940110 somatic mutation of caspase-2 is rare in gastric and colorectal carcinomas.
21903589 ras-induced down-regulation of caspase-2 represents a novel mechanism by which oncogenic Ras protects malignant intestinal epithelial cells from anoikis
21828056 Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
21726810 Caspase-2 directly cleaves the E3 ubiquitin ligase Mdm2 at Asp 367, leading to loss of the C-terminal RING domain responsible for p53 ubiquitination.
21475302 Data suggest that this novel role of caspase-2 as a translational regulator of p21 expression occurs not only independently of its enzymatic activity but also does not require known caspase-2-activating platforms.
21332795 analyzed cancer tissues from acute leukemias, breast cancers, lung cancers, and liver cancers for the detection of caspase-2 somatic mutations
21051981 The changes of caspase-2 and caspase-5 activities could be indicative of their involvement in the cervical malignancy mechanisms.
20978129 Activation of caspase-9, but not caspase-2 or caspase-8, is essential for heat-induced apoptosis in Jurkat cells.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20402676 Observational study of gene-disease association. (HuGE Navigator)
20208132 The expressions of PIDD and RAIDD are upregulated during tumour progression in renal cell carcinomas.
20187765 caspase-2 activation is commonly associated with induction of IFN-beta-induced apoptosis in IFN-beta-sensitive melanoma cells
20158568 This review discusses recent advances that have been made to help elucidate the true role of caspase 2 and the potential contribution of caspase-2 to the pathology of human diseases including cancer.
20143425 we suggest that caspase-2 and/or -8 plays an important role in regulating gamma-secretase and may possibly provide a basis for the development of therapeutics targeting apoptosis
19935698 caspase 2 functions as an endogenous inhibitor of NFkappaB-dependent cell survival and this mechanism may contribute to tumor suppression in humans.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19738422 Data show that the N-t-boc-Daidzein induced apoptosis is characterized by caspase activation, XIAP and AKT degradation.
19730412 The data demonstrate that cell death is prevented during mitosis through the inhibitory phosphorylation of caspase-2 and suggest that under conditions of mitotic arrest, cdk1-cyclin B1 activity must be overcome for apoptosis to occur.
19715609 Data indicate that caspase activity was not essential for docetaxel-induced cytotoxicity since cell death associated with lysosomal membrane permeabilization still occurred in the presence of caspase inhibitors.
19604093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19414860 Observational study of gene-disease association. (HuGE Navigator)
19347032 DISC-mediated activation of caspase 2 in DNA damage-induced apoptosis is reported.
19269008 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
18840686 RBM5 binds to casp-2 pre-mRNA at a U/C-rich sequence immediately upstream of the previously identified In100 splicing repressor element
18418048 Downregulation of caspase 2 levels by p53 may help to determine cell fate by preventing cell death when unnecessary.
18413747 Rottlerin induces down-regulation of caspase-2 via PKC delta-independent but ubiquitin proteasome-mediated pathway.
18375382 Although knockdown of c-Myc or caspase-2 does not affect Bax expression, caspase-2 is important for cytosolic Bax to integrate into the outer mitochondrial membrane, and c-Myc is critical for oligomerization of Bax once integrated into the membrane
18238895 p53-mediated apoptosis occurs by a PIDD- and caspase 2-dependent mechanism, and p53's full transcriptional regulatory functions may be required only for events that are downstream of cytochrome c release
18166155 control of caspase-2 exon 9 inclusion by topoisomerase inhibitors depends on phosphorylation and/or dephosphorylation events, and on the cell cycle phase
17945178 Interestingly, nuclear DNA fragmentation occurred and consistently DNA fragmentation factor (DFF45)/Inhibitor of caspase-activated DNase (ICAD) was cleaved inside the cell as well as in vitro, suggesting a role of caspase-2 in nuclear DNA fragmentation.
17637755 PIDD isoforms are capable of activating nuclear factor-kappaB in response to genotoxic stress, but only isoform 1 interacts with RIP-associated ICH-1/CED-3 homologous protein with a death domain and activates caspase-2.
17627033 Data suggest that caspase 2-mediated programmed cell death participates in the seizure-induced degenerative process in experimental and human TLE.
17195089 Data show that histone deacetylase inhibition leads to decreased protein kinase casein kinase 2 activity, caspase-2 activation and partial cleavage of caspase-8 that sensitizes the tumor cell to TRAIL.
17159900 PIDD autoproteolysis marks the bifurcation between pro-death caspase-2 and pro-survival NF-kappaB pathway
17079734 Caspase-9 is not only required for DeltaPsi(M) loss but also for caspase-2 activation, suggesting that these two events are downstream of the apoptosome
16843824 mechanistic studies identify a functional link between reactive oxygen specie and the caspase cascade involving caspase 2 and cleavage of BclXL
16822901 caspase-2 is activated at the DISC but does not play an initiating role in the CD95-induced apoptosis.
16777994 analysis of novel mechanisms for apoptosis induction by silibinin involving p53-caspase 2 activation and caspase-mediated cleavage of Cip1/p21
16387548 the function of an additional SREBP-1 responsive element located in the first intron of caspase-2 gene
16227610 CASP-2 gene is a member of the SREBP-responsive gene battery that senses lipid levels in cells and raise the possibility that caspase-2 participates in the control of cholesterol and triacylglycerol levels.
16193064 The activated caspase-2 processes procaspase-8 monomers between the large and small subunits, thereby priming cancer cells for TNF-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis.
16172118 proteolytic activation of Bid and the subsequent induction of the mitochondrial apoptotic pathway through Bax/Bak is essential for apoptosis triggered by caspase-2
15843892 procaspase-2S-mediated anti-apoptotic effects are associated with inhibition of the processing and activation of procaspase-3 in VP-16-treated cells
15817479 Bcl-2-modulated caspase-2 activity occurred upstream of mitochondria
15590671 human casp2 CARD domain is sufficient for activation of NF-kB and p38 MAPK
15555560 glucocorticoid modulatory element-binding protein 1 (GMEB1) is capable of binding to the prodomain of caspase-2; GMEB1 may be an endogenous inhibitory protein that selectively interacts with prodomain of caspase-2 to disrupt the autoactivation
15511269 caspase-2, -6 and -7 expression in gastric cancer cells is decreased compared to in normal gastric mucosal cells
15297885 analysis of the biochemical mechanism of caspase-2 activation
15262979 caspase-2 and caspase-8 activation have roles in the mitochondrial apoptotic pathway induced by ceramide or etoposide
15173176 caspase-2 has a role in cleavage of Bid
15073321 activation of caspase-2 occurs in a complex that contains PIDD, whose expression is induced by p53, and RAIDD; increased PIDD expression resulted in spontaneous activation of caspase-2 and sensitization to apoptosis by genotoxic stimuli
14716300 Apoptosis signaling triggered by ascididemin is routed via CASP2 and JNK to mitochondria.
14701762 engineered a p53-mutant breast cancer cell line, Hs578T, to inducibly express HOXA5. Expression of HOXA5 can induce apoptosis through an apoptotic mechanism mediated by caspases 2 and 8.
14647455 Bax plays an important role in UV-induced apoptosis and in caspase-2 activation in tumor cells.
14623896 apoptosis was preceded by proteolytic cleavage of caspases 2, 3, and 7, and wild type STAT1 also induced cleavage of caspase 7
14584591 caspase 7 and caspase 8, but not caspase 2, are involved in induction of apoptosis by sphingosine
12920126 the x-ray structure of caspase-2 in complex with the inhibitor acetyl-Leu-Asp-Glu-Ser-Asp-aldehyde at 1.65-A resolution; the intersubunit disulfide bridge stabilizes the dimeric form
12837286 CASP2 expression was elevated upon RNF36 induction in test cells.
12598307 The short isoform is overexpressed in macrophage-derived foam cells of human atherosclerotic plaques
12584573 caspase-2 gene: alternative promoters, pre-mRNA splicing and AUG usage direct isoform-specific expression
12193789 cytotoxic stress causes activation of caspase-2, and this caspase is required for the permeabilization of mitochondria
12145703 The long isoform of pro-CASP2 decreased first in mitochondria, then cytosol, then microsomes, and finally accumulated in the nucleus of U937 cells during TPA-induced differentiation.
12065594 acts upstream of mitochondria to promote cytochrome c release during etoposide-induced apoptosis
11832478 Caspase-2 induces apoptosis by releasing proapoptotic proteins from mitochondria.
11823470 role in cytochrome C release and apoptosis from the nucleus

AA Sequence

MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEM      1 - 70
RELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSL     71 - 140
PFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHF    141 - 210
TGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVE    211 - 280
GAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGK    281 - 350
EKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGY    351 - 420
APGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT                                          421 - 452
//

Text Mined References (139)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26962687 2016 MiR-125a-5p decreases after long non-coding RNA HOTAIR knockdown to promote cancer cell apoptosis by releasing caspase 2.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
25330190 2014 Transcriptomic analysis unveils correlations between regulative apoptotic caspases and genes of cholesterol homeostasis in human brain.
25301067 2015 Caspase-2 impacts lung tumorigenesis and chemotherapy response in vivo.
25151963 2015 Fatty acid synthase inhibition engages a novel caspase-2 regulatory mechanism to induce ovarian cancer cell death.
25114039 2014 Caspase-2 regulates oncogene-induced senescence.
25010987 2014 Attenuation of the ELAV1-like protein HuR sensitizes adenocarcinoma cells to the intrinsic apoptotic pathway by increasing the translation of caspase-2L.
24727569 2014 Combined suppression of CASP2 and CASP6 protects retinal ganglion cells from apoptosis and promotes axon regeneration through CNTF-mediated JAK/STAT signalling.
24321384 2014 Exon 9 skipping of apoptotic caspase-2 pre-mRNA is promoted by SRSF3 through interaction with exon 8.
24292555 2014 ER stress does not cause upregulation and activation of caspase-2 to initiate apoptosis.
23568547 2013 miR-708 promotes the development of bladder carcinoma via direct repression of Caspase-2.
23553630 2013 Metabolomic profiling reveals a role for caspase-2 in lipoapoptosis.
23469978 2013 Importance of transcript levels of caspase-2 isoforms S and L for breast carcinoma progression.
23404198 2013 TRIM16 overexpression induces apoptosis through activation of caspase-2 in cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23042294 2012 IRE1? cleaves select microRNAs during ER stress to derepress translation of proapoptotic Caspase-2.
22825847 2012 Degradomics reveals that cleavage specificity profiles of caspase-2 and effector caspases are alike.
22531785 2012 Caspase-2 is an initiator caspase responsible for pore-forming toxin-mediated apoptosis.
22486813 2012 Sorting nexin 5 of a new diagnostic marker of papillary thyroid carcinoma regulates Caspase-2.
22396545 2012 Tumor-suppressing function of caspase-2 requires catalytic site Cys-320 and site Ser-139 in mice.
22201672 2011 TAp73alpha protects small cell lung carcinoma cells from caspase-2 induced mitochondrial mediated apoptotic cell death.
22174370 2012 Nucleotide excision repair factor XPC enhances DNA damage-induced apoptosis by downregulating the antiapoptotic short isoform of caspase-2.
22077397 2012 Induction of caspase-2 activation by a DNA enzyme evokes tumor cell apoptosis.
22002103 2012 5-Phenylselenyl- and 5-methylselenyl-methyl-2'-deoxyuridine induce oxidative stress, DNA damage, and caspase-2-dependent apoptosis in cancer cells.
21940110 2011 Somatic mutations of caspase-2 gene in gastric and colorectal cancers.
21903589 2011 Oncogenic ras-induced down-regulation of pro-apoptotic protease caspase-2 is required for malignant transformation of intestinal epithelial cells.
21828056 2011 Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
21726810 2011 Caspase-2-mediated cleavage of Mdm2 creates a p53-induced positive feedback loop.
21475302 2011 Caspase-2 is required for DNA damage-induced expression of the CDK inhibitor p21(WAF1/CIP1).
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21332795 2011 Somatic mutation of proapoptotic caspase-2 gene is rare in acute leukemias and common solid cancers.
21269460 2011 Initial characterization of the human central proteome.
21051981 2010 Indication of participation of caspase-2 and caspase-5 in mechanisms of human cervical malignancy.
20978129 2010 Activation of caspase-9, but not caspase-2 or caspase-8, is essential for heat-induced apoptosis in Jurkat cells.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20402676 2010 Mutational analysis of caspase genes in prostate carcinomas.
20208132 2010 PIDDosome expression and the role of caspase-2 activation for chemotherapy-induced apoptosis in RCCs.
20187765 2010 Increased caspase-2 activity is associated with induction of apoptosis in IFN-beta sensitive melanoma cell lines.
20158568 2010 The role of caspase-2 in stress-induced apoptosis.
20143425 2010 Caspases-2 and -8 are involved in the presenilin1/gamma-secretase-dependent cleavage of amyloid precursor protein after the induction of apoptosis.
19935698 2010 Caspase 2-mediated tumor suppression involves survivin gene silencing.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19738422 2009 7-(O)-Carboxymethyl daidzein conjugated to N-t-Boc-hexylenediamine: a novel compound capable of inducing cell death in epithelial ovarian cancer stem cells.
19730412 2009 Restraint of apoptosis during mitosis through interdomain phosphorylation of caspase-2.
19715609 2009 Docetaxel-induced prostate cancer cell death involves concomitant activation of caspase and lysosomal pathways and is attenuated by LEDGF/p75.
19604093 2009 Genetic polymorphisms, their allele combinations and IFN-beta treatment response in Irish multiple sclerosis patients.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19414860 2009 Genetic variation in caspase genes and risk of non-Hodgkin lymphoma: a pooled analysis of 3 population-based case-control studies.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19347032 2009 DISC-mediated activation of caspase-2 in DNA damage-induced apoptosis.
19269008 2009 Mutational analysis of CASP1, 2, 3, 4, 5, 6, 7, 8, 9, 10, and 14 genes in gastrointestinal stromal tumors.
19075813 2008 Efficient cleavage of Bid and procaspase-7 by caspase-2 at lower pH.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18840686 2008 Up-regulation of the proapoptotic caspase 2 splicing isoform by a candidate tumor suppressor, RBM5.
18418048 2008 Caspase 2 is both required for p53-mediated apoptosis and downregulated by p53 in a p21-dependent manner.
18413747 2008 Down-regulation of caspase-2 by rottlerin via protein kinase C-delta-independent pathway.
18375382 2008 c-Myc and caspase-2 are involved in activating Bax during cytotoxic drug-induced apoptosis.
18309324 2008 No death without life: vital functions of apoptotic effectors.
18238895 2008 A role for caspase 2 and PIDD in the process of p53-mediated apoptosis.
18166155 2008 PKC zeta controls DNA topoisomerase-dependent human caspase-2 pre-mRNA splicing.
17945178 2007 Caspase-2 cleaves DNA fragmentation factor (DFF45)/inhibitor of caspase-activated DNase (ICAD).
17902043 2007 Increased caspase-2, calpain activations and decreased mitochondrial complex II activity in cells expressing exogenous huntingtin exon 1 containing CAG repeat in the pathogenic range.
17637755 2008 p53-induced protein with a death domain (PIDD) isoforms differentially activate nuclear factor-kappaB and caspase-2 in response to genotoxic stress.
17627033 2007 Increased expression of caspase 2 in experimental and human temporal lobe epilepsy.
17195089 2007 Histone deacetylase inhibitors enhance Ad5-TRAIL killing of TRAIL-resistant prostate tumor cells through increased caspase-2 activity.
17159900 2007 Autoproteolysis of PIDD marks the bifurcation between pro-death caspase-2 and pro-survival NF-kappaB pathway.
17079734 2007 Loss of caspase-9 reveals its essential role for caspase-2 activation and mitochondrial membrane depolarization.
16843824 2006 ROS-triggered caspase 2 activation and feedback amplification loop in beta-carotene-induced apoptosis.
16822901 2006 Caspase-2 is activated at the CD95 death-inducing signaling complex in the course of CD95-induced apoptosis.
16777994 2006 Silibinin activates p53-caspase 2 pathway and causes caspase-mediated cleavage of Cip1/p21 in apoptosis induction in bladder transitional-cell papilloma RT4 cells: evidence for a regulatory loop between p53 and caspase 2.
16652156 2006 Functional connection between p53 and caspase-2 is essential for apoptosis induced by DNA damage.
16387548 2005 Identification of a functional DNA binding site for the SREBP-1c transcription factor in the first intron of the human caspase-2 gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16227610 2005 Caspase-2, a novel lipid sensor under the control of sterol regulatory element binding protein 2.
16193064 2005 Caspase-2 primes cancer cells for TRAIL-mediated apoptosis by processing procaspase-8.
16172118 2005 Essential roles of the Bcl-2 family of proteins in caspase-2-induced apoptosis.
15843892 2005 Procaspase-2S inhibits procaspase-3 processing and activation, preventing ROCK-1-mediated apoptotic blebbing and body formation in human B lymphoma Namalwa cells.
15817479 2005 Bcl-2 rescues ceramide- and etoposide-induced mitochondrial apoptosis through blockage of caspase-2 activation.
15735701 2005 Caspase-9 can antagonize p53-induced apoptosis by generating a p76(Rb) truncated form of Rb.
15590671 2005 A novel caspase-2 complex containing TRAF2 and RIP1.
15555560 2004 Regulation of procaspase-2 by glucocorticoid modulatory element-binding protein 1 through the interaction with caspase recruitment domain.
15511269 2004 Loss of caspase-2, -6 and -7 expression in gastric cancers.
15500642 2004 Plakin proteins are coordinately cleaved during apoptosis but preferentially through the action of different caspases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15297885 2004 The biochemical mechanism of caspase-2 activation.
15262979 2004 Sequential caspase-2 and caspase-8 activation upstream of mitochondria during ceramideand etoposide-induced apoptosis.
15173176 2004 Caspase-2 can function upstream of bid cleavage in the TRAIL apoptosis pathway.
15073321 2004 The PIDDosome, a protein complex implicated in activation of caspase-2 in response to genotoxic stress.
14716300 2004 Apoptosis signaling triggered by the marine alkaloid ascididemin is routed via caspase-2 and JNK to mitochondria.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701762 2004 HOXA5-induced apoptosis in breast cancer cells is mediated by caspases 2 and 8.
14647455 2004 Bax deficiency affects caspase-2 activation during ultraviolet radiation-induced apoptosis.
14623896 2004 STAT1-induced apoptosis is mediated by caspases 2, 3, and 7.
14584591 2003 Functional role of caspases in sphingosine-induced apoptosis in human hepatoma cells.
12920126 2003 Crystal structure of caspase-2, apical initiator of the intrinsic apoptotic pathway.
12853948 2003 The DNA sequence of human chromosome 7.
12837286 2003 Forced expression of RNF36 induces cell apoptosis.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12598307 2003 Overexpression of the anti-apoptotic caspase-2 short isoform in macrophage-derived foam cells of human atherosclerotic plaques.
12584573 2003 The human caspase-2 gene: alternative promoters, pre-mRNA splicing and AUG usage direct isoform-specific expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12193789 2002 Requirement for caspase-2 in stress-induced apoptosis before mitochondrial permeabilization.
12145703 2002 Intracellular redistribution of procaspases during TPA-induced differentiation of U937 human leukemic cells.
12107826 2002 Caspase-2 is not required for thymocyte or neuronal apoptosis even though cleavage of caspase-2 is dependent on both Apaf-1 and caspase-9.
12065594 2002 Caspase-2 acts upstream of mitochondria to promote cytochrome c release during etoposide-induced apoptosis.
12011445 2002 Cyclin D3 activates Caspase 2, connecting cell proliferation with cell death.
11832478 2002 Caspase-2 induces apoptosis by releasing proapoptotic proteins from mitochondria.
11830582 2002 Structure-function analysis of NADE: identification of regions that mediate nerve growth factor-induced apoptosis.
11425872 2001 Apoptotic cleavage of cytoplasmic dynein intermediate chain and p150(Glued) stops dynein-dependent membrane motility.
11399776 2001 Caspase-2-induced apoptosis is dependent on caspase-9, but its processing during UV- or tumor necrosis factor-dependent cell death requires caspase-3.
11350957 2001 Characterization of a novel proapoptotic caspase-2- and caspase-9-binding protein.
11313953 2001 Modulation of apoptosis by procaspase-2 short isoform: selective inhibition of chromatin condensation, apoptotic body formation and phosphatidylserine externalization.
11278287 2001 14-3-3 is involved in p75 neurotrophin receptor-mediated signal transduction.
11156409 2000 Identification of a caspase-2 isoform that behaves as an endogenous inhibitor of the caspase cascade.
11076957 2001 Molecular cloning and characterization of DEFCAP-L and -S, two isoforms of a novel member of the mammalian Ced-4 family of apoptosis proteins.
10980123 2000 PAX2 suppresses apoptosis in renal collecting duct cells.
10791974 2000 Caspase-2 is localized at the Golgi complex and cleaves golgin-160 during apoptosis.
10329646 1999 Nod1, an Apaf-1-like activator of caspase-9 and nuclear factor-kappaB.
10079193 1999 Changes in caspase expression in Alzheimer's disease: comparison with development and aging.
9847074 1998 Toward a complete human genome sequence.
9792675 1998 Caspase-14 is a novel developmentally regulated protease.
9695946 1998 Solution structure of the RAIDD CARD and model for CARD/CARD interaction in caspase-2 and caspase-9 recruitment.
9560245 1998 ARC, an inhibitor of apoptosis expressed in skeletal muscle and heart that interacts selectively with caspases.
9261102 1997 Activation of caspase-2 in apoptosis.
9228018 1997 FLAME-1, a novel FADD-like anti-apoptotic molecule that regulates Fas/TNFR1-induced apoptosis.
9044836 1997 CRADD, a novel human apoptotic adaptor molecule for caspase-2, and FasL/tumor necrosis factor receptor-interacting protein RIP.
8985253 1997 RAIDD is a new 'death' adaptor molecule.
8962078 1996 Molecular ordering of the Fas-apoptotic pathway: the Fas/APO-1 protease Mch5 is a CrmA-inhibitable protease that activates multiple Ced-3/ICE-like cysteine proteases.
8780721 1996 Chromosomal localization of the human genes, CPP32, Mch2, Mch3, and Ich-1, involved in cellular apoptosis.
8654923 1996 The Caenorhabditis elegans cell-death protein CED-3 is a cysteine protease with substrate specificities similar to those of the human CPP32 protease.
8087842 1994 Ich-1, an Ice/ced-3-related gene, encodes both positive and negative regulators of programmed cell death.
8044845 1994 Crystal structure of the cysteine protease interleukin-1 beta-converting enzyme: a (p20/p10)2 homodimer.
7789948 1995 Apoptosis regulatory gene NEDD2 maps to human chromosome segment 7q34-35, a region frequently affected in haematological neoplasms.