Property Summary

NCBI Gene PubMed Count 32
PubMed Score 415.08
PubTator Score 32.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.100 4.2e-16
non-small cell lung carcinoma -1.500 1.2e-24

 GO Component (1)

Gene RIF (27)

AA Sequence

MADEKPSNGVLVHMVKLLIKTFLDGIFDDLMENNVLNTDEIHLIGKCLKFVVSNAENLVDDITETAQTAG      1 - 70
KIFREHLWNSKKQLSSDISSDGEREANMPGLNIRNKEFNYLHNRNGSELDLLGMRDLLENLGYSVVIKEN     71 - 140
LTAQEMETALRQFAAHPEHQSSDSTFLVFMSHSILNGICGTKHWDQEPDVLHDDTIFEIFNNRNCQSLKD    141 - 210
KPKVIIMQACRGNGAGIVWFTTDSGKAGADTHGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHE    211 - 280
TNGSVFISQIIYYFREYSWSHHLEEIFQKVQHSFETPNILTQLPTIERLSMTRYFYLFPGN             281 - 341
//

Text Mined References (33)

PMID Year Title