Property Summary

NCBI Gene PubMed Count 30
PubMed Score 347.68
PubTator Score 32.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.200 6.7e-18
non-small cell lung carcinoma -1.500 1.2e-24

Synonym

Accession Q6UXS9 D6RBN7 CASP-12
Symbols CASP-12
CASP12P1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

 IMPC Phenotype (1)

Gene RIF (24)

PMID Text
26582949 Expression of caspase-12 was linked to decreased systemic and adipose tissue inflammation in a cohort of African American obese children.
26261584 Endoplasmic reticulum stress related factor ATF6 and caspase-12 trigger apoptosis in neonatal hypoxic-ischemic encephalopathy.
25503380 We found that RNA interference-induced Caspase-12 silencing increased NOD1, hBD1 and hBD2 expression
24586588 conclude that the functional CASP12L allele is not a marker for susceptibility and/or severity of CAP
24515649 Distribution of CASP12 alleles (#rs497116) in African-Americans (AA) with rheumatoid arthritis (RA). There was no difference in the overall distribution of genotypes within AA with RA, but homozygous patients had lower baseline joint-narrowing scores.
24224909 EtOH-induced activation of caspase-12 could be one of the underlying mechanisms of hepatocyte apoptosis.
21872999 examines the role that CASP12 plays in down-regulating inflammation, we hypothesize that pathogens which exploit the inflammatory response are restrained by an active CASP12 gene product
21706251 CASPASE-12 does not influence the susceptibility to Candida sepsis, nor has any effect on the serum cytokine concentrations in Candida sepsis patients during the course of infection.
20646990 Constitutively active forms of caspase-12 (rev-Deltapro1 and rev-Deltapro2) could induce cell death in cells transfected with the corresponding expression vectors.
20577092 Observational study of gene-disease association. (HuGE Navigator)
20423816 Observational study of gene-disease association. (HuGE Navigator)
20299368 Observational study of gene-disease association. (HuGE Navigator)
20299359 Reactive oxygen species promote caspase-12 expression and tubular apoptosis in diabetic nephropathy.
20041182 The calcium-calpain-caspase-12-caspase-3 cascade is altered in F508del-CFTR expressing cells.
19721713 the NOD2/RIP2 pathway has a role in recognition of Yersinia, but caspase-12 does not modulate innate host defense against Y. pestis
19447924 estrogen-mediated inhibition of Csp-12L expression is a built-in mechanism that has evolved to protect females from Listeria monocytogenes infection.
18791174 hRPE cells express a high level of caspase-12S. The regulated expression of caspase-12S suggests that this caspase recruitment domain (CARD)-only protein may be an endogenous dominant negative regulator that modulates inflammatory responses in hRPE cells.
18332441 proteolytic activity of caspase-12 is confined to its own proenzyme
17574210 The activation of caspase-9 and depolarization of mitochondrial membrane potential were induced by BIK, which were decreased concomitant with caspase-12 silenced.
16917906 Observational study of genotype prevalence. (HuGE Navigator)
15129283 Csp12-L attenuates the inflammatory and innate immune response to endotoxins and in doing so may constitute a risk factor for developing sepsis
15033764 Na/Ca exchanger overexpression activates caspase-12
14532116 Pathways involving this enzyme are involved in a neurodegenerative disease in vivo, and thus offer novel potential targets for the treatment of prion disorders.
12054529 caspase 12 has acquired deleterious mutations

AA Sequence

MADEKPSNGVLVHMVKLLIKTFLDGIFDDLMENNVLNTDEIHLIGKCLKFVVSNAENLVDDITETAQTAG      1 - 70
KIFREHLWNSKKQLSSDISSDGEREANMPGLNIRNKEFNYLHNRNGSELDLLGMRDLLENLGYSVVIKEN     71 - 140
LTAQEMETALRQFAAHPEHQSSDSTFLVFMSHSILNGICGTKHWDQEPDVLHDDTIFEIFNNRNCQSLKD    141 - 210
KPKVIIMQACRGNGAGIVWFTTDSGKAGADTHGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHE    211 - 280
TNGSVFISQIIYYFREYSWSHHLEEIFQKVQHSFETPNILTQLPTIERLSMTRYFYLFPGN             281 - 341
//

Text Mined References (31)

PMID Year Title
26582949 2016 Caspase-12, but Not Caspase-11, Inhibits Obesity and Insulin Resistance.
26261584 2015 ER stress related factor ATF6 and caspase-12 trigger apoptosis in neonatal hypoxic-ischemic encephalopathy.
25503380 2014 Caspase-12 silencing attenuates inhibitory effects of cigarette smoke extract on NOD1 signaling and hBDs expression in human oral mucosal epithelial cells.
24586588 2014 Lack of association of the caspase-12 long allele with community-acquired pneumonia in people of African descent.
24515649 2014 CASPASE-12 and rheumatoid arthritis in African-Americans.
24224909 2014 The resveratrol attenuates ethanol-induced hepatocyte apoptosis via inhibiting ER-related caspase-12 activation and PDE activity in vitro.
21872999 2011 A possible mechanism for maintenance of the deleterious allele of human CASPASE-12.
21706251 2012 The impact of caspase-12 on susceptibility to candidemia.
20646990 2010 Purification of catalytically active caspase-12 and its biochemical characterization.
20577092 2010 Genetic variation of innate immune genes in HIV-infected african patients with or without oropharyngeal candidiasis.
20423816 2010 Persistence of full-length caspase-12 and its relation to malaria in West and Central African populations.
20299368 2010 Examination of association with candidate genes for diabetic nephropathy in a Mexican American population.
20299359 2010 Reactive oxygen species promote caspase-12 expression and tubular apoptosis in diabetic nephropathy.
20041182 2009 The calpain, caspase 12, caspase 3 cascade leading to apoptosis is altered in F508del-CFTR expressing cells.
20031604 2009 Genome-wide association scan identifies variants near Matrix Metalloproteinase (MMP) genes on chromosome 11q21-22 strongly associated with serum MMP-1 levels.
19721713 2009 Caspase-12 and the inflammatory response to Yersinia pestis.
19447924 2009 Gender differences in expression of the human caspase-12 long variant determines susceptibility to Listeria monocytogenes infection.
18791174 2008 Regulated expression of caspase-12 gene in human retinal pigment epithelial cells suggests its immunomodulating role.
18332441 2008 Confinement of caspase-12 proteolytic activity to autoprocessing.
17574210 2007 Apoptosis induced by BIK was decreased with RNA interference of caspase-12.
16917906 2006 Population distribution of the functional caspase-12 allele.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16532395 2006 Spread of an inactive form of caspase-12 in humans is due to recent positive selection.
15129283 2004 Differential modulation of endotoxin responsiveness by human caspase-12 polymorphisms.
15033764 2003 Na/Ca exchanger overexpression induces endoplasmic reticulum stress, caspase-12 release, and apoptosis.
14532116 2003 Caspase-12 and endoplasmic reticulum stress mediate neurotoxicity of pathological prion protein.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12054529 2002 Human caspase 12 has acquired deleterious mutations.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
10638761 2000 Caspase-12 mediates endoplasmic-reticulum-specific apoptosis and cytotoxicity by amyloid-beta.
9038361 1997 Characterization of seven murine caspase family members.