Property Summary

NCBI Gene PubMed Count 226
PubMed Score 1655.15
PubTator Score 917.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (24)

Disease log2 FC p
nephrosclerosis 1.318 2.4e-04
chronic lymphocytic leukemia -1.038 2.1e-02
Multiple myeloma 1.388 3.7e-02
malignant mesothelioma -4.400 5.9e-09
cutaneous lupus erythematosus 1.800 2.5e-04
psoriasis 2.100 1.3e-04
glioblastoma 2.800 2.3e-04
cystic fibrosis 1.383 5.3e-04
medulloblastoma, large-cell -1.300 3.4e-03
juvenile dermatomyositis 1.276 2.0e-08
chronic kidney disease 1.200 4.9e-02
non-small cell lung cancer -1.228 1.1e-11
colon cancer -1.500 2.6e-02
lung cancer -3.900 3.5e-07
active Crohn's disease 2.552 1.4e-03
ulcerative colitis 2.300 2.6e-05
Breast cancer 3.800 2.6e-02
adult high grade glioma 1.700 4.7e-04
pilocytic astrocytoma 1.900 2.4e-09
primary Sjogren syndrome 1.400 5.7e-05
subependymal giant cell astrocytoma 2.500 3.6e-02
lung adenocarcinoma -1.060 1.0e-02
lung carcinoma -2.800 6.6e-27
ovarian cancer -2.900 6.5e-08

Protein-protein Interaction (9)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
896 confirmatory 13 / 10 / 35 Confirmation Concentration-Response Assay for Allosteric/Competitive Inhibitors of Caspase-1
900 confirmatory 21 / 3015 / 71992 qHTS Assay for Allosteric/Competitive Inhibitors of Caspase-1
2389 summary 6 / 0 / 0 qHTS Assay for Allosteric/Competitive Inhibitors of Caspase-1: Summary
2494 confirmatory 9 / 0 / 1 Confirmation Assay for Allosteric/Competitive Inhibitors of Caspase-1
488857 screening 563 / 0 / 812 Single concentration confirmation of inhibitors of NALP1 in yeast using a Caspase-1-ASC counter screen.
488863 confirmatory 30 / 0 / 11 Dose Response confirmation of inhibitors of NALP1 in yeast using a Caspase-1-ASC counter screen.

Gene RIF (161)

PMID Text
26599267 These results suggest that released caspase-1 exists in a unique complex that is functionally stable and protected from immunodepletion whereas cell-extract generated active caspase-1 is rapidly inhibited in the cytosolic milieu.
26510601 Changes in the tertiary structure of mutated pyrin B30.2 domain interrupting the formation of the pyrin-caspase-1 complex are related to the manifestations of Mediterranean familial fever.
26496436 Genetic polymorphisms in Nalp3 and caspase-1 may be associated with individual susceptibility to silicosis, especially when the polymorphisms interact with age, cumulative dust exposure, or smoking status.
26466953 Internalized Cryptococcus neoformans Activates the Canonical Caspase-1 and the Noncanonical Caspase-8 Inflammasomes.
26457439 The proteins of NLRP3, ASC, and caspase-1 were observed in infiltrating inflammatory cells in cholesteatoma and chronic otitis media.
26453510 The results indicate that acteoside may act as a regulator of the IL-32 induced immune responses.
26324711 Interleukin-1alpha Activity in Necrotic Endothelial Cells Is Controlled by Caspase-1 Cleavage of Interleukin-1 Receptor-2
26324708 production of 20-kDa IL-1beta may act to limitIL-1beta signaling by reducing the pool of pro-IL-1beta availability for caspase-1 cleavage
26240347 the rs713875 IBD risk polymorphism increases MTMR3 expression, which modulates pattern recognition receptor (PRR)-induced outcomes, including increased induced caspase-1 activation
26218605 specific caspase cleavage sites in Kaposi's sarcoma-associated herpesvirus latency-associated nuclear antigen function to blunt apoptosis as well as interfere with the caspase-1-mediated inflammasome
26168332 Data suggest activation of CASP1 (caspase-1) and secretion of IL18 (interleukin 18)/IFNG (interferon-gamma) in mucosal explants of ileum/colon are related to intensity of inflammatory lesions in patients with active, long-standing Crohn's disease.
25938942 The NLRP3-CASP1 inflammasome modulates cellular levels of the glucocorticoid receptor and diminishes cell sensitivity to glucocorticoids.
25806508 In patients with HIV, serum CASP1 levels in a group with high CD4 cell counts increased rapidly then decreased within a short time during early HIV-1 infection. In contrast, CASP1 levels in the CD4Low group were increased after 1 year of HIV-1 infection.
25759090 In contrast, inhibition of the protease activity of Kgp, RgpA or RgpB increased the human caspase-1-activating potential of wild-type Porphyromonas gingivalis, indicating an inhibitory effect of the collaborative action of gingipains.
25684031 NLRP3 and caspase-1 are expressed in the odontoblast layers in normal human dental pulp tissue, whereas in inflamed pulp tissue, the odontoblast layers are disrupted and dental pulp cells are positive for NLRP3 and caspase-1.
25658455 The study shows that A1AT does not inhibit human monocyte caspase-1.
25589411 three cofactor independent human monoclonal aPL can induce transcription of NLRP3 and caspase-1 resulting in inflammasome activation specific for NLRP3, which depends fully on activation of endosomal NADPH-oxidase-2 (NOX2) by aPL
25567507 ASC interacts with NALP3 and caspase-1 via different domains.
25562666 There may be a protective role of caspase-1 in keratinocytes during UVB-induced skin cancer development through the induction of apoptosis.
25452302 studies demonstrate a role of Nedd8 in regulating caspase-1 activation following inflammasome activation
25403406 proinflammatory (caspase 1) and initiator (caspases 8 and 10) caspases in the syncytiotrophoblast and capillary endotheliocytes of the terminal villi are higher in induced pregnancies.
25372293 caspase-1/ASC inflammasomes play a significant role in the activation of IL-1beta/ROS and NF-kappaB signaling of cytokine gene expression for T. cruzi control in human and mouse macrophages.
25330190 the inflammatory CASP1 is linked to several genes involved in cholesterol homeostasis. These correlations resulted in altered GBM (Glioblastoma Multiforme), in particular for CASP1
25284686 caspase 1 was higher in degenerated intervertebral discs than in healthy controls.
25174821 this study provides novel evidence that NRG induces growth inhibition and apoptosis by inhibiting the NF-kappaB/COX-2-caspase-1 pathway and that a positive interaction between NF-kappaB and COX-2 pathway contributes to the growth and antiapoptotic effect
25061439 mRNA levels of CASP1 were significantly higher in freshly isolated PBMCs from Chronic recurrent multifocal osteomyelitis patients in active disease than in healthy controls
24954757 The relative level of aortic caspase-1 expression was elevated in patients who were smokers or with hypertension or diabetes.
24947802 Study used Markov stability community detection to perform a multiscale analysis of the structure of caspase-1 which revealed that the active conformation has a weaker, less compartmentalised large-scale structure compared to the inactive conformation, resulting in greater intra-protein coherence and signal propagation.
24701032 caspase-1, IL-1beta, and IL-18 are regulated by AIM2, which mediates inflammation-associated renal damage in hepatitis B virus-associated glomerulonephritis
24699513 The NOD-like receptor NLRP1a/Caspase-1 pathway is the best candidate to mediate the parasite-induced cell death.
24481253 Caspase-1 is required for nuclear translocation of intracellular IL-37 and for secretion of mature IL-37.
24453977 NLRP12/NLRP3-dependent activation of caspase-1 is likely to be a key event in mediating systemic production of IL-1beta and hypersensitivity to secondary bacterial infection during malaria.
24356306 cell death by caspase 1-mediated pyroptosis drives CD4 T-cell depletion in HIV-1 infection; this death pathway thus links the two signature events in HIV infection--CD4 T-cell depletion and chronic inflammation
24275551 leptin enhances IL-18 secretion via modulation of the caspase-1 inflammasome function but has no effect on IL-1betamRNA levels or IL-1beta secretion.
24158569 Identify a novel innate immune signaling pathway (NLRP3-ASC-caspase-1-IL-1beta) activated by Ni(2+).
24130483 Targeting of the deneddylase activity to the nucleus is dependent on processing of the catalytic N-terminus by caspase-1.
24022484 Lactic acidosis, induced by the addition of 25 mm lactic acid, also induced the release of 20-kDa IL-1beta. This 20-kDa product was produced independently of NLRP3 and caspase-1 but was inhibited by the cathepsin D inhibitor pepstatin A.
23884363 These results show that late caspase-1 activation within DENV-infected monocytes can contribute to pro-inflammatory outcomes that might play a role in dengue immunopathogenesis.
23839215 Study shows that T. gondii-induced IL-1beta production is dependent on the classical inflammasome components caspase-1 and ASC.Additionally, a role for a specific parasite factor, dense granule protein GRA15, in T. gondii induction of IL-1beta was demonstrated.
23793845 Studies suggest that caspase 1, IL-1 beta and IL-18 are involved in inflammasosme activation and prostate cancer initiation.
23703390 Caspase-1 is a de novo trasncrptional taget gene of tp63 protein.
23637985 Oxidized low density lipoprotein induced caspase-1 mediated pyroptotic cell death in macrophages
23590971 Results suggest that the Fas signal favors the Th17-phenotypic features of T cells through the caspase-1/Stat3 signaling pathway.
23508996 The charge surface of the NLRP1 CARD structure and a procaspase-1 CARD model suggests potential mechanisms for their association through electrostatic attraction
23386603 Substrate and inhibitor-induced dimerization and cooperativity in caspase-1 but not caspase-3
23278288 P. acnes is an inducer of caspase-1 in neutrophils, and thus generating both IL-1beta and IL-18 production.
23236067 during cytomegalovirus infection, pUL29/28 and pUL38 contributed to inhibition of p21CIP1 and caspase 1 expression; expression of pUL29/28 and pUL38 contributed to an increase in steady-state levels of p53; study identified 2 additional HCMV proteins, pUL29/28 and pUL38, which participate in regulation of p53 transcription activity
23226468 Monocyte/macrophage-expressed A1PI-M antagonizes IL-1beta secretion possibly via caspase-1 inhibition.
23209292 Deubiquitinases regulate the activity of caspase-1 and interleukin-1beta secretion via assembly of the inflammasome
23190696 Data indicate that thymic stromal lymphopoietin (TSLP) expression was induced by IL-32 via activation of caspase-1.
23021143 Caspase-1 plays an important role in the airway epithelial cell response to influenza infection, which is enhanced in asthmatic volunteers, and may contribute to the enhanced influenza-related pathogenesis observed in vivo.
22837397 A polymorphism associated with reduced expression of a putative methionine salvage pathway dehydratase, apoptotic protease activating factor 1 (APAF1)-interacting protein (APIP), was associated with increased caspase-1-mediated cell death in Salmonella.
22833538 DAta suggest that decreased enzymatic activity of caspase-1 is compatible with normal life and does not prevent moderate and severe autoinflammation.
22537218 lower secretion by peritoneal macrophages in endometriosis
22491736 A molecular and computational diagnostic approach identifies FOXP3, ICOS, CD52 and CASP1 as the most informative biomarkers in acute graft-versus-host disease.
22227487 Twelve single nucleotide polymorphisms within NLRP1, NLRP3, NLRC4, CARD8, CASP1, and IL1B genes were analyzed in 150 HIV-1-infected Brazilian subjects.
22046441 type-I and type-II IFNs induce the expression of IFI16, AIM2, and inflammasome proteins to various extents in THP-1 cells and the expression of IFI16 protein in THP-1 cells suppresses the activation of caspase-1 by the AIM2 and NLRP3 inflammasomes
21862623 The increased intrinsic caspase-1 activity in visceral adipose tissue represents a novel and specific inflammatory pathway that may determine the proinflammatory character of this specific depot.
21862576 the CARD of procaspase-1 is differently involved in the formation of procaspase-1 activating platforms and procaspase-1-mediated, RIP2-dependent NF-kappaB activation.
21832064 Caspase-1 protein induces apoptosis-associated speck-like protein containing a caspase recruitment domain (ASC)-mediated necrosis independently of its catalytic activity.
21792841 Innate immune signaling contributes to systemic sclerosis fibrosis via activation of the inflammasome and caspase 1.
21757759 the high degree of substrate specificity displayed by caspase-1 is maintained through rapid spontaneous inactivation of this protease.
21463955 TSLP can be expressed and produced through caspase-1 and NF-kappaB in mast cells
21320026 Inhibitory effects of chelidonic acid on IL-6 production by blocking NF-kappaB and caspase-1 in HMC-1 cells.
21311905 CASP1 is a modifier gene for the time of progression from mild cognitive impairment to Alzheimer's disease
21052690 Carriers of the 5352 A allele in the caspase-1 gene are at increased risk of developing late-acquired stent malapposition after sirolimus-eluting stent implantation.
21052690 Observational study of gene-disease association. (HuGE Navigator)
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21037509 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20959405 Observational study of gene-disease association. (HuGE Navigator)
20855536 Observational study of gene-disease association. (HuGE Navigator)
20852925 HIV-1 Vpr-induced apoptosis involves activation of caspases and the involvement of caspase 1 is suggested based on studies with mice transgenic for the HIV-1 vpr gene
20808838 the role of NLRP3 (NALP3), its adaptor protein PYCARD (ASC), and caspase-1 during infection with Mycobacterium tuberculosis
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20402676 Observational study of gene-disease association. (HuGE Navigator)
20197547 Cleavage of sphingosine kinase 2 by caspase-1 provokes its release from apoptotic cells.
20184726 Caspase 1 genetic variation (G+7/in6A, rs501192) was no differences in the genotypic, allelic or haplotypic distributions between cases and controls.
20184726 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20170165 Data show that Benzyl- or cyclohexylamines produced potent, reversible, and competitive inhibitors that were selective for caspase-1 over caspases 3 and 8 with minimal cytotoxicity.
20060974 Caspase-1 recognizes extended cleavage sites in its natural substrates
20048342 The caspase-1 cleavage site in Mal is part of a TIR-domain interaction site.
20038581 NALP3 inflammasome is constitutively assembled and activated with cleavage of caspase-1 in human melanoma cells
19913121 Observational study of gene-disease association. (HuGE Navigator)
19833722 Results show that Rab39a interacts with caspase-1 and suggest that Rab39a functions as a trafficking adaptor linking caspase-1 to IL-1beta secretion.
19825518 In vitro inhibition of the mevalonate pathway by statins specifically increases the production, by activated monocytes, of cytokines of the IL-1 family, by enhancing caspase-1 activity.
19779610 monocytes are capable of delivering a cell death message which depends upon the release of microvesicles containing functional caspase-1
19773279 Observational study of gene-disease association. (HuGE Navigator)
19737897 These results demonstrate that B. anthracis PGA elicits IL-1beta production through activation of ICE in PMA-differentiated THP-1 cells and hMoDCs, suggesting the potential for PGA as a therapeutic target for anthrax.
19648107 Data show that elevated levels of reactive oxygen species are responsible for NLRP3-dependent caspase-1 activation in Chlamydia trachomatis infected cells.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19439663 caspase-1 processing results in inactivation of IL-33, rather than activation.
19414860 Observational study of gene-disease association. (HuGE Navigator)
19382257 Gene silencing of caspase-1 or inhibition of caspase-1 activity led to reduction in dengue virus-induced apoptosis with minimal effect on virus replication.
19275586 HIV-1 Vpr-induced apoptosis involves activation of caspases and the involvement of caspase 1 is suggested based on studies with mice transgenic for the HIV-1 vpr gene
19269008 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19141860 Observational study of gene-disease association. (HuGE Navigator)
19117953 Crystal structure of procaspase-1 zymogen domain reveals insight into inflammatory caspase autoactivation
19074885 Observational study of gene-disease association. (HuGE Navigator)
19013323 HIV-1 Vpr-induced apoptosis involves activation of caspases and the involvement of caspase 1 is suggested based on studies with mice transgenic for the HIV-1 vpr gene
18981155 a novel mechanism that negatively regulates RIG-I-mediated signaling activity via caspase-1-dependent secretion of RIG-I protein.
18828051 The presence and concentration of caspase-1 in the amniotic fluid varies as a function of gestational age. Women with spontaneous labor at term had a higher median caspase-1 amniotic fluid concentration than women at term without labor.
18799371 Frameshift mutation at a mononucleotide repeat in CASP1 is rare in gastric and colorectal carcinomas with microsatellite instability.
18590738 X-ray crystal structures of caspase-1 variants suggest the importance of both the salt bridge interaction and the coordination of solvent water molecules near the allosteric binding pocket.
18577712 pyrin is cleaved by caspase-1 at Asp330, a site remote from the B30.2 domain
18550243 Data show that Mexico City dogs exhibit frontal white matter upregulation of two important inflammatory genes: COX2 and IL1beta, compared to age-matched control dogs from a low polluted area.
18523309 Signaling via NADPH oxidase activity is fundamental for the processing of mature IL-1 beta induced in monocytes by ATP receptor P2X7R and caspase-1 activation.
18329368 Study shows that secretion of the leaderless proteins proIL-1alpha, caspase-1, and fibroblast growth factor (FGF)-2 depends on caspase-1 activity.
18304957 Observational study of gene-disease association. (HuGE Navigator)
18263805 Relative copy numbers for the inflammasome mRNAs for ASC, caspase-1, NALP1, and Pypaf-7 were significantly lower in patients with septic shock compared with critically ill control subjects.
18263705 up-regulated in pancreatic sections and in isolated islets from type 2 diabetic patients
18209072 Triggering of cytosolic RNA recognition pathway with poly(I:C) transfection or influenza A virus infection resulted in caspase-1- and -3-mediated proteolytic processing of pro-IL-18 and secretion of biologically active IL-18.
17959595 characterization of caspase-1 substrates identifies the glycolysis pathway as a caspase-1 target and provides new insights into its function during pyroptosis and septic shock.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17623017 identification of a novel function of HIPPI; it binds to specific upstream sequences of the caspase-1, caspase-8 and caspase-10 genes and alters the expression of the genes
17597823 the activity of caspase-1 is increased in psoriatic skin and IL-18 secretion is regulated by a p38 MAPK/caspase-1-dependent mechanism
17477815 Observational study of gene-disease association. (HuGE Navigator)
17418785 Antiapoptotic proteins Bcl-2 and Bcl-X(L) bind and suppress NALP1, reducing caspase-1 activation and interleukin-1beta (IL-1beta) production.
17360653 Caspase-1 plays a role in the regulation of Toll-like receptors-2 and -4 signaling pathways via an effect on MyD88 adapter-like protein.
17303764 Caspase-1 is upregulated in human heart failure and acts as a potent proapoptotic caspase both in isolated human cardiomyocytes and in vivo.
17173859 In summary, we showed that HIPPI could interact with the putative promoter sequence of caspase-1 and increased the expression of the downstream gene suggesting that HIPPI could act as transcription regulator.
17036048 pannexin-1 is required for processing of caspase-1 and release of mature IL-1beta induced by P2X(7) receptor activation.
16920334 Cop inhibition of cell death, at least to a certain extent, results from its interference with the activation of caspase-1 and caspase-4.
16903774 IL-32 is a cell-associated proinflammatory cytokine, which is specifically stimulated by mycobacteria through a caspase-1- and IL-18-dependent production of interferon gamma.
16817903 Involvement of caspase 1 and its activator Ipaf upstream of mitochondrial events in apoptosis
16785446 The C-terminal B30.2 domain of pyrin is necessary and sufficient for the interaction with caspase-1 to modulate IL-1beta production.
16780720 Data show that expression of Caspase-1 was significantly increased in the hippocampus of the developing recurrent seizures rats.
16778130 Observational study of gene-disease association. (HuGE Navigator)
16621994 proinflammatory response mediated by statins in activated peripheral blood mononuclear cells is mediated mainly via the activation of caspase-1 and interleukin-18 secretion in the monocytes and to a lesser extent by interleukin-12
16428475 Increased plasma levels of caspase-1 is associated with cutaneous T-cell lymphoma
16405550 Interleukin-1 Beta gene polymorphism is associated with precancerous lesions in African Americans and Caucasians.
16260731 IL-32 synergizes with nucleotide oligomerization domain (NOD) 1 and NOD2 ligands for IL-1beta and IL-6 production through a caspase 1-dependent mechanism.
16123779 results show that Csp-1 is an upstream positive regulator of Csp-6-mediated cell death in primary human neurons; also results suggest that the activation of Csp-1 must be accompanied by an apoptotic insult to induce Csp-6-mediated cell death
16087165 VLDL induces IL-1beta mRNA expression, caspase-1 activation, and IL-1beta release from macrophages
16037825 data suggest that both pyrin and cryopyrin are capable of assembling independent inflammasome complexes with ASC and procaspase-1, and activating caspase-1 via ASC oligomerization
15809717 epigenetic events such as DNA methylation and histone deacetylation play important roles in the regulation of caspase-1, and loss of caspase-1 expression is associated with poor survival in gastric carcinoma
15749123 HIV-1 Vpr-induced apoptosis involves activation of caspases and the involvement of caspase 1 is suggested based on studies with mice transgenic for the HIV-1 vpr gene
15561713 NF-kappaB- and C/EBPbeta-driven interleukin-1beta gene expression and PAK1-mediated caspase-1 activation play essential roles in interleukin-1beta release from Helicobacter pylori lipopolysaccharide-stimulated macrophages
15471361 expression of caspase-1 and IL-18 was significantly increased in multiple sclerosis patients
15326478 resistance of pro-interleukin-18 to processing by caspase 1 in ovarian tumors
15039421 caspase-1 contributes to inflammation by two distinct pathways: proteolysis of pro-IL-1beta, and RIP2-dependent activation of NF-kappaB and p38 MAPK mediated by the caspase recruitment domain
14669344 Overexpression of Caspase-1 is a frequent event in pancreatic disorders and neoplasms.
14584052 Data show that gingival fibroblasts express interleukin-1 (IL_1) beta converting enzyme mRNA, but low levels of IL-1 beta mRNA, and do not secrete interleukin-18.
12692130 Caspases responsible for parkin cleavage were identified by several experimental paradigms exploring the anti-Fas induced pathway and tnf-alpha pathway.
12628757 Exposure to a cytotoxic concentration of gp120 up-regulates expression of the inducible isoform of cyclooxygenase (COX-2) in neuroblastoma cells and this is blocked by caspase 1 inhibitors
12459463 Caspase 1 has a role in T-cell protein tyrosine phosphatase-induced apoptosis in a human tumor cell line.
12387869 activation in immune cells by PYPAF5
12215842 Differential rates of frameshift alterations in four repeat sequences of hereditary nonpolyposis colorectal cancer tumors.These repeats consisted of (A)10 in the TGF beta RII, (G)8 in the BAX, (A)8 in the CASP1, and (CCA)7 in the APP genes.
12191486 inflammasome comprises caspase-1, caspase-5, Pycard/Asc, and NALP1; a molecular platform triggering activation of inflammatory caspases and processing of proIL-beta
12170183 The caspase-1 level was significantly higher in biochemorefractory melanoma patients compared with responders, suggesting that disrupted apoptosis pathways might be involved in the progressive disease and drug resistance.
12096920 Interleukin-1F7B (IL-1H4/IL-1F7) is processed by this enzyme
12019269 regulation of activation of caspase-1-dependent cytokine processing by PYPAF7
11967258 The PYRIN-CARD protein ASC is an activating adaptor for caspase-1.
11821383 CARD-8 protein, a new CARD family member that regulates caspase-1 activation and apoptosis.
11437653 HIV-1 Vpr-induced apoptosis involves activation of caspases and the involvement of caspase 1 is suggested based on studies with mice transgenic for the HIV-1 vpr gene
10708425 HIV-1 Vpr-induced apoptosis involves activation of caspases and the involvement of caspase 1 is suggested based on studies with mice transgenic for the HIV-1 vpr gene
10438581 HIV-1 Vpr-induced apoptosis involves activation of caspases and the involvement of caspase 1 is suggested based on studies with mice transgenic for the HIV-1 vpr gene
9548463 HIV-1 Vpr-induced apoptosis involves activation of caspases and the involvement of caspase 1 is suggested based on studies with mice transgenic for the HIV-1 vpr gene
9002959 HIV-1 Vpr-induced apoptosis involves activation of caspases and the involvement of caspase 1 is suggested based on studies with mice transgenic for the HIV-1 vpr gene

AA Sequence

MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQ      1 - 70
ICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEE     71 - 140
AQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASD    141 - 210
MTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVI    211 - 280
IIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFI    281 - 350
GRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH                    351 - 404
//

Text Mined References (229)

PMID Year Title
26599267 2015 Monocyte Caspase-1 Is Released in a Stable, Active High Molecular Weight Complex Distinct from the Unstable Cell Lysate-Activated Caspase-1.
26510601 [Influence of M680I and M694V mutations on pyrin's domain B30.2 tertiary structure and it's complex formation ability with caspase-1].
26496436 2015 Effects of the Interactions between Dust Exposure and Genetic Polymorphisms in Nalp3, Caspase-1, and IL-1? on the Risk of Silicosis: A Case-Control Study.
26466953 2015 Internalized Cryptococcus neoformans Activates the Canonical Caspase-1 and the Noncanonical Caspase-8 Inflammasomes.
26457439 2016 Activation of NLRP3 inflammasome in human middle ear cholesteatoma and chronic otitis media.
26453510 2015 Attenuation of IL-32-induced caspase-1 and nuclear factor-?B activations by acteoside.
26324711 2015 Interleukin-1? Activity in Necrotic Endothelial Cells Is Controlled by Caspase-1 Cleavage of Interleukin-1 Receptor-2: IMPLICATIONS FOR ALLOGRAFT REJECTION.
26324708 2015 Acid-dependent Interleukin-1 (IL-1) Cleavage Limits Available Pro-IL-1? for Caspase-1 Cleavage.
26240347 2015 MTMR3 risk allele enhances innate receptor-induced signaling and cytokines by decreasing autophagy and increasing caspase-1 activation.
26218605 2015 Identification of Caspase Cleavage Sites in KSHV Latency-Associated Nuclear Antigen and Their Effects on Caspase-Related Host Defense Responses.
26168332 2015 Heterogeneity of subordination of the IL-18/IFN-? axis to caspase-1 among patients with Crohn's disease.
25938942 2015 NALP3 inflammasome upregulation and CASP1 cleavage of the glucocorticoid receptor cause glucocorticoid resistance in leukemia cells.
25806508 2015 Longitudinal changes in plasma Caspase-1 and Caspase-3 during the first 2 years of HIV-1 infection in CD4Low and CD4High patient groups.
25759090 2015 Contradictory roles of Porphyromonas gingivalis gingipains in caspase-1 activation.
25684031 2015 Activation of the NLRP3/caspase-1 inflammasome in human dental pulp tissue and human dental pulp fibroblasts.
25658455 2015 Alpha 1-antitrypsin does not inhibit human monocyte caspase-1.
25589411 2015 Cofactor-independent antiphospholipid antibodies activate the NLRP3-inflammasome via endosomal NADPH-oxidase: implications for the antiphospholipid syndrome.
25567507 2015 Purification and analysis of the interactions of caspase-1 and ASC for assembly of the inflammasome.
25562666 2015 Caspase-1 activity is required for UVB-induced apoptosis of human keratinocytes.
25452302 2015 Nedd8 regulates inflammasome-dependent caspase-1 activation.
25416956 2014 A proteome-scale map of the human interactome network.
25403406 2014 Caspase expression in placental terminal villi in spontaneous and induced pregnancy.
25372293 2014 Caspase-1/ASC inflammasome-mediated activation of IL-1?-ROS-NF-?B pathway for control of Trypanosoma cruzi replication and survival is dispensable in NLRP3-/- macrophages.
25330190 2014 Transcriptomic analysis unveils correlations between regulative apoptotic caspases and genes of cholesterol homeostasis in human brain.
25284686 2015 Enhanced NLRP3, caspase-1, and IL- 1? levels in degenerate human intervertebral disc and their association with the grades of disc degeneration.
25174821 2014 Naringin inhibits growth and induces apoptosis by a mechanism dependent on reduced activation of NF??B/COX?2?caspase-1 pathway in HeLa cervical cancer cells.
25061439 2014 Deregulation of the IL-1? axis in chronic recurrent multifocal osteomyelitis.
24954757 2014 Overexpression of caspase-1 in aorta of patients with coronary atherosclerosis.
24947802 2014 Uncovering allosteric pathways in caspase-1 using Markov transient analysis and multiscale community detection.
24701032 2014 AIM2 mediates inflammation-associated renal damage in hepatitis B virus-associated glomerulonephritis by regulating caspase-1, IL-1?, and IL-18.
24699513 2014 A highly conserved Toxo1 haplotype directs resistance to toxoplasmosis and its associated caspase-1 dependent killing of parasite and host macrophage.
24630722 2014 Unified polymerization mechanism for the assembly of ASC-dependent inflammasomes.
24548080 2014 CDK5 protects from caspase-induced Ataxin-3 cleavage and neurodegeneration.
24481253 2014 Role of caspase-1 in nuclear translocation of IL-37, release of the cytokine, and IL-37 inhibition of innate immune responses.
24453977 2014 Malaria-induced NLRP12/NLRP3-dependent caspase-1 activation mediates inflammation and hypersensitivity to bacterial superinfection.
24356306 2014 Cell death by pyroptosis drives CD4 T-cell depletion in HIV-1 infection.
24275551 2014 Leptin enhances the secretion of interleukin (IL)-18, but not IL-1?, from human monocytes via activation of caspase-1.
24158569 2014 Nickel induces interleukin-1? secretion via the NLRP3-ASC-caspase-1 pathway.
24130483 2013 Caspase-1 promotes Epstein-Barr virus replication by targeting the large tegument protein deneddylase to the nucleus of productively infected cells.
24022484 2013 Acidosis drives damage-associated molecular pattern (DAMP)-induced interleukin-1 secretion via a caspase-1-independent pathway.
23884363 2013 Dengue virus-infected human monocytes trigger late activation of caspase-1, which mediates pro-inflammatory IL-1? secretion and pyroptosis.
23839215 2013 Human innate immunity to Toxoplasma gondii is mediated by host caspase-1 and ASC and parasite GRA15.
23793845 2013 Role of inflammasomes and their regulators in prostate cancer initiation, progression and metastasis.
23703390 2013 Caspase-1 is a novel target of p63 in tumor suppression.
23637985 2013 Oxidized low density lipoprotein induced caspase-1 mediated pyroptotic cell death in macrophages: implication in lesion instability?
23590971 2013 Expression of Th17-related genes in PHA/IL-2-activated human T cells by Fas signaling via caspase-1- and Stat3-dependent pathway.
23508996 2013 Structure of the NLRP1 caspase recruitment domain suggests potential mechanisms for its association with procaspase-1.
23386603 2013 Substrate and inhibitor-induced dimerization and cooperativity in caspase-1 but not caspase-3.
23278288 2013 Propionibacterium acnes activates caspase-1 in human neutrophils.
23236067 2013 Human cytomegalovirus pUL29/28 and pUL38 repression of p53-regulated p21CIP1 and caspase 1 promoters during infection.
23226468 2012 Cytosolic, autocrine alpha-1 proteinase inhibitor (A1PI) inhibits caspase-1 and blocks IL-1? dependent cytokine release in monocytes.
23209292 2013 Deubiquitinases regulate the activity of caspase-1 and interleukin-1? secretion via assembly of the inflammasome.
23190696 2012 Interleukin-32-induced thymic stromal lymphopoietin plays a critical role in macrophage differentiation through the activation of caspase-1 in vitro.
23021143 2012 Influenza enhances caspase-1 in bronchial epithelial cells from asthmatic volunteers and is associated with pathogenesis.
22837397 2012 Functional genetic screen of human diversity reveals that a methionine salvage enzyme regulates inflammatory cell death.
22833538 2013 Naturally occurring genetic variants of human caspase-1 differ considerably in structure and the ability to activate interleukin-1?.
22537218 2012 Imbalance in cytokines from interleukin-1 family - role in pathogenesis of endometriosis.
22491736 2012 A molecular and computational diagnostic approach identifies FOXP3, ICOS, CD52 and CASP1 as the most informative biomarkers in acute graft-versus-host disease.
22227487 2012 Polymorphisms in inflammasome' genes and susceptibility to HIV-1 infection.
22046441 2011 IFI16 protein mediates the anti-inflammatory actions of the type-I interferons through suppression of activation of caspase-1 by inflammasomes.
22046355 2011 Anti-GBM glomerulonephritis involves IL-1 but is independent of NLRP3/ASC inflammasome-mediated activation of caspase-1.
21862623 2011 The inflammasome and caspase-1 activation: a new mechanism underlying increased inflammatory activity in human visceral adipose tissue.
21862576 2011 Interaction patches of procaspase-1 caspase recruitment domains (CARDs) are differently involved in procaspase-1 activation and receptor-interacting protein 2 (RIP2)-dependent nuclear factor ?B signaling.
21832064 2011 Caspase-1 protein induces apoptosis-associated speck-like protein containing a caspase recruitment domain (ASC)-mediated necrosis independently of its catalytic activity.
21792841 2011 The inflammasome activating caspase 1 mediates fibrosis and myofibroblast differentiation in systemic sclerosis.
21757759 2011 Caspase-1 promiscuity is counterbalanced by rapid inactivation of processed enzyme.
21463955 2011 Thymic stromal lymphopoietin is expressed and produced by caspase-1/NF-?B pathway in mast cells.
21320026 2011 Inhibitory effects of chelidonic acid on IL-6 production by blocking NF-?B and caspase-1 in HMC-1 cells.
21311905 2011 Genetic variation in caspase-1 as predictor of accelerated progression from mild cognitive impairment to Alzheimer's disease.
21269460 2011 Initial characterization of the human central proteome.
21052690 2011 The 5352 A allele of the pro-inflammatory caspase-1 gene predicts late-acquired stent malapposition in STEMI patients treated with sirolimus stents.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21037509 2010 Variants of ADAMTS1 modify the effectiveness of statins in reducing the risk of myocardial infarction.
20959405 2010 The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20808838 2010 Granuloma formation and host defense in chronic Mycobacterium tuberculosis infection requires PYCARD/ASC but not NLRP3 or caspase-1.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20402676 2010 Mutational analysis of caspase genes in prostate carcinomas.
20197547 2010 Cleavage of sphingosine kinase 2 by caspase-1 provokes its release from apoptotic cells.
20184726 2010 Caspase-1 genetic variation is not associated with Alzheimer's disease risk.
20170165 2010 Noncovalent tripeptidyl benzyl- and cyclohexyl-amine inhibitors of the cysteine protease caspase-1.
20060974 2010 Caspase-1 recognizes extended cleavage sites in its natural substrates.
20048342 2010 Caspase-1 targets the TLR adaptor Mal at a crucial TIR-domain interaction site.
20038581 2010 Constitutively active inflammasome in human melanoma cells mediating autoinflammation via caspase-1 processing and secretion of interleukin-1beta.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19833722 2009 Rab39a binds caspase-1 and is required for caspase-1-dependent interleukin-1beta secretion.
19825518 2009 Specific increase in caspase-1 activity and secretion of IL-1 family cytokines: a putative link between mevalonate kinase deficiency and inflammation.
19779610 2009 Monocyte derived microvesicles deliver a cell death message via encapsulated caspase-1.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19737897 2010 Bacillus anthracis capsule activates caspase-1 and induces interleukin-1beta release from differentiated THP-1 and human monocyte-derived dendritic cells.
19648107 2009 Inflammasome-dependent caspase-1 activation in cervical epithelial cells stimulates growth of the intracellular pathogen Chlamydia trachomatis.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19439663 2009 The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1.
19414860 2009 Genetic variation in caspase genes and risk of non-Hodgkin lymphoma: a pooled analysis of 3 population-based case-control studies.
19382257 2009 Gene expression profiling by microarray analysis reveals an important role for caspase-1 in dengue virus-induced p53-mediated apoptosis.
19269008 2009 Mutational analysis of CASP1, 2, 3, 4, 5, 6, 7, 8, 9, 10, and 14 genes in gastrointestinal stromal tumors.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19158679 2009 An orthogonal proteomic-genomic screen identifies AIM2 as a cytoplasmic DNA sensor for the inflammasome.
19158676 2009 AIM2 activates the inflammasome and cell death in response to cytoplasmic DNA.
19141860 2009 Genetic variants in the candidate genes of the apoptosis pathway and susceptibility to chronic myeloid leukemia.
19117953 2009 Crystal structure of procaspase-1 zymogen domain reveals insight into inflammatory caspase autoactivation.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18981155 2008 Active caspase-1-mediated secretion of retinoic acid inducible gene-I.
18828051 2008 Evidence of the involvement of caspase-1 under physiologic and pathologic cellular stress during human pregnancy: a link between the inflammasome and parturition.
18799371 2009 Frameshift mutation at a mononucleotide repeat in CASP1 is rare in gastric and colorectal carcinomas with microsatellite instability.
18590738 2008 An allosteric circuit in caspase-1.
18577712 2008 The familial Mediterranean fever protein, pyrin, is cleaved by caspase-1 and activates NF-kappaB through its N-terminal fragment.
18550243 2008 Air pollution, cognitive deficits and brain abnormalities: a pilot study with children and dogs.
18523309 2008 A key role for redox signaling in rapid P2X7 receptor-induced IL-1 beta processing in human monocytes.
18329368 2008 Active caspase-1 is a regulator of unconventional protein secretion.
18304957 2008 Genetic variation in the interleukin-1 beta-converting enzyme associates with cognitive function. The PROSPER study.
18263805 2008 Inflammasome mRNA expression in human monocytes during early septic shock.
18263705 2008 Glucose and leptin induce apoptosis in human beta-cells and impair glucose-stimulated insulin secretion through activation of c-Jun N-terminal kinases.
18209072 2008 Cytosolic antiviral RNA recognition pathway activates caspases 1 and 3.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17959595 2007 The caspase-1 digestome identifies the glycolysis pathway as a target during infection and septic shock.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17623017 2007 Interactions of HIPPI, a molecular partner of Huntingtin interacting protein HIP1, with the specific motif present at the putative promoter sequence of the caspase-1, caspase-8 and caspase-10 genes.
17597823 2007 The activity of caspase-1 is increased in lesional psoriatic epidermis.
17477815 2007 Polymorphisms in proinflammatory genes and susceptibility to typhoid fever and paratyphoid fever.
17418785 2007 Bcl-2 and Bcl-XL regulate proinflammatory caspase-1 activation by interaction with NALP1.
17360653 2007 NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1.
17303764 2007 A role for caspase-1 in heart failure.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17196042 2006 A high-resolution map of synteny disruptions in gibbon and human genomes.
17173859 2007 Interaction of HIPPI with putative promoter sequence of caspase-1 in vitro and in vivo.
17036048 2006 Pannexin-1 mediates large pore formation and interleukin-1beta release by the ATP-gated P2X7 receptor.
16920334 2006 Protective role of Cop in Rip2/caspase-1/caspase-4-mediated HeLa cell death.
16903774 2006 Mycobacterium tuberculosis induces interleukin-32 production through a caspase- 1/IL-18/interferon-gamma-dependent mechanism.
16817903 2006 Involvement of caspase 1 and its activator Ipaf upstream of mitochondrial events in apoptosis.
16785446 2006 The B30.2 domain of pyrin, the familial Mediterranean fever protein, interacts directly with caspase-1 to modulate IL-1beta production.
16780720 2006 [Expression and significance of caspase-1, IL-18 and IL-1beta in the hippocampus of the developing recurrent seizures rats].
16778130 2006 Haplotypes of the caspase-1 gene, plasma caspase-1 levels, and cardiovascular risk.
16621994 2006 Statin-induced proinflammatory response in mitogen-activated peripheral blood mononuclear cells through the activation of caspase-1 and IL-18 secretion in monocytes.
16575408 2006 The estrogen-responsive B box protein: a novel enhancer of interleukin-1beta secretion.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16428475 2006 Expression of interleukin-18 and caspase-1 in cutaneous T-cell lymphoma.
16405550 2006 Association of interleukin-1beta gene polymorphisms with precancerous gastric lesions in African Americans and Caucasians.
16260731 2005 IL-32 synergizes with nucleotide oligomerization domain (NOD) 1 and NOD2 ligands for IL-1beta and IL-6 production through a caspase 1-dependent mechanism.
16123779 2006 Caspase-1 activation of caspase-6 in human apoptotic neurons.
16087165 2005 Very low-density lipoprotein induces interleukin-1beta expression in macrophages.
16037825 2006 Cryopyrin and pyrin activate caspase-1, but not NF-kappaB, via ASC oligomerization.
15809717 2005 Loss of caspase-1 gene expression in human gastric carcinomas and cell lines.
15561713 2005 NF-kappaB- and C/EBPbeta-driven interleukin-1beta gene expression and PAK1-mediated caspase-1 activation play essential roles in interleukin-1beta release from Helicobacter pylori lipopolysaccharide-stimulated macrophages.
15498465 2004 Caspase-1zeta, a new splice variant of the caspase-1 gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471361 2004 Increased expression of caspase-1 and interleukin-18 in peripheral blood mononuclear cells in patients with multiple sclerosis.
15383541 2004 INCA, a novel human caspase recruitment domain protein that inhibits interleukin-1beta generation.
15326478 2004 A novel isoform of pro-interleukin-18 expressed in ovarian tumors is resistant to caspase-1 and -4 processing.
15296730 2004 Crystal structures of a ligand-free and malonate-bound human caspase-1: implications for the mechanism of substrate binding.
15107016 2004 Heterotypic interactions among NACHT domains: implications for regulation of innate immune responses.
15039421 2004 Caspase-1 activates nuclear factor of the kappa-enhancer in B cells independently of its enzymatic activity.
15030775 2004 NALP3 forms an IL-1beta-processing inflammasome with increased activity in Muckle-Wells autoinflammatory disorder.
14669344 2003 Overexpression of Caspase-1 in adenocarcinoma of pancreas and chronic pancreatitis.
14584052 2004 Gingival and dermal fibroblasts produce interleukin-1 beta converting enzyme and interleukin-1 beta but not interleukin-18 even after stimulation with lipopolysaccharide.
12888622 2003 Caspase cleavage of tau: linking amyloid and neurofibrillary tangles in Alzheimer's disease.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12692130 2003 Caspase-1 and caspase-8 cleave and inactivate cellular parkin.
12628757 2003 Caspase-1 inhibitors abolish deleterious enhancement of COX-2 expression induced by HIV-1 gp120 in human neuroblastoma cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459463 2002 A nuclear protein tyrosine phosphatase activates p53 and induces caspase-1-dependent apoptosis.
12459189 2002 Nod1, a CARD protein, enhances pro-interleukin-1beta processing through the interaction with pro-caspase-1.
12387869 2002 Functional screening of five PYPAF family members identifies PYPAF5 as a novel regulator of NF-kappaB and caspase-1.
12215842 2002 Differential rates of frameshift alterations in four repeat sequences of hereditary nonpolyposis colorectal cancer tumors.
12191486 2002 The inflammasome: a molecular platform triggering activation of inflammatory caspases and processing of proIL-beta.
12170183 2002 Serum caspase-1 levels in metastatic melanoma patients: relationship with tumour burden and non-response to biochemotherapy.
12096920 2002 Interleukin-1F7B (IL-1H4/IL-1F7) is processed by caspase-1 and mature IL-1F7B binds to the IL-18 receptor but does not induce IFN-gamma production.
12019269 2002 PYPAF7, a novel PYRIN-containing Apaf1-like protein that regulates activation of NF-kappa B and caspase-1-dependent cytokine processing.
11997061 2002 Caspase-1 expression in multiple sclerosis plaques and cultured glial cells.
11967258 2002 The PYRIN-CARD protein ASC is an activating adaptor for caspase-1.
11953316 2002 Caspase-6 gene disruption reveals a requirement for lamin A cleavage in apoptotic chromatin condensation.
11821383 2002 CARD-8 protein, a new CARD family member that regulates caspase-1 activation and apoptosis.
11536016 2001 Regulation of IL-1beta generation by Pseudo-ICE and ICEBERG, two dominant negative caspase recruitment domain proteins.
11472070 2001 CLAN, a novel human CED-4-like gene.
11438643 2001 Transcription factor AP-2alpha is preferentially cleaved by caspase 6 and degraded by proteasome during tumor necrosis factor alpha-induced apoptosis in breast cancer cells.
11437653 2001 T cell apoptosis causes peripheral T cell depletion in mice transgenic for the HIV-1 vpr gene.
11432859 2001 Cop, a caspase recruitment domain-containing protein and inhibitor of caspase-1 activation processing.
11390368 2001 Identification of Ipaf, a human caspase-1-activating protein related to Apaf-1.
11374873 2001 Human CARD12 is a novel CED4/Apaf-1 family member that induces apoptosis.
11226410 2001 Proteolytic cleavage of epidermal growth factor receptor by caspases.
11085743 2000 Initiation of apoptosis by granzyme B requires direct cleavage of bid, but not direct granzyme B-mediated caspase activation.
11051551 2000 ICEBERG: a novel inhibitor of interleukin-1beta generation.
10799503 2000 The prodomain of caspase-1 enhances Fas-mediated apoptosis through facilitation of caspase-8 activation.
10708425 2000 Human immunodeficiency virus type 1 vpr induces apoptosis through caspase activation.
10660263 1999 Expression and hormonal regulation of rat ovarian interleukin-1beta converting enzyme, a putative apoptotic marker: endocrine- and paracrine-dependence.
10510468 1999 Identification of NRF2, a member of the NF-E2 family of transcription factors, as a substrate for caspase-3(-like) proteases.
10438581 1999 Roles of p53 and caspases in the induction of cell cycle arrest and apoptosis by HIV-1 vpr.
10353249 1999 Inhibition of caspase-1 slows disease progression in a mouse model of Huntington's disease.
10329646 1999 Nod1, an Apaf-1-like activator of caspase-9 and nuclear factor-kappaB.
10069390 1999 Identification of caspases that cleave presenilin-1 and presenilin-2. Five presenilin-1 (PS1) mutations do not alter the sensitivity of PS1 to caspases.
9990034 1999 Phosphorylation of presenilin-2 regulates its cleavage by caspases and retards progression of apoptosis.
9987822 1999 Peptide based interleukin-1 beta converting enzyme (ICE) inhibitors: synthesis, structure activity relationships and crystallographic study of the ICE-inhibitor complex.
9894612 1998 Calpain activation is upstream of caspases in radiation-induced apoptosis.
9875225 1998 Cleavage of human cytosolic phospholipase A2 by caspase-1 (ICE) and caspase-8 (FLICE).
9830039 1998 Shigella-induced apoptosis is dependent on caspase-1 which binds to IpaB.
9804161 1998 Rapid cytochrome c release, activation of caspases 3, 6, 7 and 8 followed by Bap31 cleavage in HeLa cells treated with photodynamic therapy.
9792675 1998 Caspase-14 is a novel developmentally regulated protease.
9727491 1998 Bid, a Bcl2 interacting protein, mediates cytochrome c release from mitochondria in response to activation of cell surface death receptors.
9705938 1998 Identification of CARDIAK, a RIP-like kinase that associates with caspase-1.
9705209 1998 Caspase-mediated fragmentation of calpain inhibitor protein calpastatin during apoptosis.
9632733 1998 Phosphorylation of PITSLRE p110 isoforms accompanies their processing by caspases during Fas-mediated cell death.
9593687 1998 Caspase-mediated cleavage of the ubiquitin-protein ligase Nedd4 during apoptosis.
9535906 1998 Caspase cleavage of gene products associated with triplet expansion disorders generates truncated fragments containing the polyglutamine tract.
9435230 1998 Modulation of cell death by Bcl-XL through caspase interaction.
9334338 1997 p28 Bap31, a Bcl-2/Bcl-XL- and procaspase-8-associated protein in the endoplasmic reticulum.
9334240 1997 Involvement of caspase-1 and caspase-3 in the production and processing of mature human interleukin 18 in monocytic THP.1 cells.
9250871 1997 Interleukin-1beta-converting enzyme (ICE) and related cell death genes ICErel-II and ICErel-III map to the same PAC clone at band 11q22.2-22.3.
9219695 1997 Alternative cleavage of Alzheimer-associated presenilins during apoptosis by a caspase-3 family protease.
9190289 1997 A combinatorial approach for determining protease specificities: application to interleukin-1beta converting enzyme (ICE).
9115219 1997 Cleavage of PITSLRE kinases by ICE/CASP-1 and CPP32/CASP-3 during apoptosis induced by tumor necrosis factor.
9070648 1997 Actin cleavage by CPP-32/apopain during the development of apoptosis.
8999548 1997 Activation of interferon-gamma inducing factor mediated by interleukin-1beta converting enzyme.
8978814 1996 Lamin proteolysis facilitates nuclear events during apoptosis.
8861900 1996 Human ICE/CED-3 protease nomenclature.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8044845 1994 Crystal structure of the cysteine protease interleukin-1 beta-converting enzyme: a (p20/p10)2 homodimer.
8035875 1994 Structure and mechanism of interleukin-1 beta converting enzyme.
8034320 1994 Molecular characterization of the gene for human interleukin-1 beta converting enzyme (IL1BC).
7876192 1995 Cloning and expression of four novel isoforms of human interleukin-1 beta converting enzyme with different apoptotic activities.
7797510 1995 Identification and characterization of ICH-2, a novel member of the interleukin-1 beta-converting enzyme family of cysteine proteases.
7721861 1995 Expression, refolding, and autocatalytic proteolytic processing of the interleukin-1 beta-converting enzyme precursor.
7642516 1995 Cleavage of poly(ADP-ribose) polymerase by interleukin-1 beta converting enzyme and its homologs TX and Nedd-2.
1919001 1991 IL-1-converting enzyme requires aspartic acid residues for processing of the IL-1 beta precursor at two distinct sites and does not cleave 31-kDa IL-1 alpha.
1574116 1992 A novel heterodimeric cysteine protease is required for interleukin-1 beta processing in monocytes.
1373520 1992 Molecular cloning of the interleukin-1 beta converting enzyme.
1321594 1992 Purification of interleukin-1 beta converting enzyme, the protease that cleaves the interleukin-1 beta precursor.