Property Summary

NCBI Gene PubMed Count 28
PubMed Score 180.16
PubTator Score 20.57

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
oligodendroglioma 1.400 4.1e-03
psoriasis -1.300 1.5e-03
osteosarcoma -1.396 1.4e-04
medulloblastoma, large-cell 1.100 1.7e-04
group 4 medulloblastoma 1.100 3.8e-06

 MGI Phenotype (1)

Protein-protein Interaction (186)

POM121C   DDX39A   IGF2BP3   NUPL2   NUDT21   CDC40   ZC3H11A   NUP155   PCF11   SLU7   CPSF4   RPLP1   RPLP2   RPLP0   EIF4E   RPS17   RPSA   PABPC1   TPR   RPS2   RPL35A   RPL7   RPL17   RPS4Y1   RPS3   EIF4B   RPS12   U2AF2   RPL13   ZFP36   RPL10   RPL12   RPL9   CSTF2   RPL22   NUP214   RPL4   NUP62   RPS19   RPL3   RPL13A   APOBEC1   RPS27   RPL35   RPL27A   RPL5   RPL21   RPL28   RPS9   RPS5   RPS10   RPL29   RPL34   NUP153   RANBP2   RPL14   PAPOLA   NUP98   NUP107   EIF4A1   RPS20   RPS3A   RPL26   RPL15   RPL27   RPL37A   RPL37   RPS7   RPS8   RPS15A   RPS16   RPS14   RPS23   RPS18   RPS29   RPS13   RPS11   RPL7A   RPS4X   RPL23A   RPS6   RPL23   RPS15   RPS24   RPS25   RPS26   RPS28   FAU   RPL30   RPL39   RPL31   RPL10A   RPL32   RPL11   RPL8   RPL41   RPS27A   UBA52   RPL38   RPS21   PPP2CA   RAE1   RPL24   RPL36A   RPL19   SRSF3   U2AF1   SRSF2   RPL18A   RPL6   EIF4G1   CSTF1   SRSF11   RPL18   ZFP36L1   SRSF1   SRSF4   CPSF1   CSTF3   SRSF9   SRSF5   SRSF6   HNRNPD   EIF4A2   RNPS1   SRSF7   PAN2   PAN3   NUP188   THOC7   FIP1L1   NUP54   PABPN1   SMG6   ALYREF   THOC6   SRRM1   GSPT2   NUP93   CPSF7   SMG8   NUP43   NUP37   NUP35   THOC2   NUP210   U2AF1L4   NUP133   SMG7   DHX38   NUP205   SYMPK   UPF1   KHSRP   CLP1   MAGOHB   SEH1L   THOC1   POM121   THOC3   SMG1   NUP88   NDC1   NUP58   NUP85   POLDIP3   UPF3B   WDR33   NXF2B   PAIP1   CSTF2T   SMG9   UPF3A   UPF2   A1CF   IGF2BP1   CPSF2   NXF1   CPSF3   NXT1   NUP50   SMG5   RPL36   CHTOP   RBM8A   IGF2BP2  

Gene RIF (6)

PMID Text
23530232 MLN51, alone or as part of the EJC, interacts directly with the pivotal eukaryotic translation initiation factor eIF3
22190034 HIV-1 gp120 is identified to have a physical interaction with cancer susceptibility candidate 3 (CASC3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21327427 MLN51 is a key factor in fibroblast-like synoviocyte hyperplasia of rheumatoid arthritis patients.
17652158 MLN51 is recruited into cytoplasmic aggregates known as stress granules (SGs) together with the SG-resident proteins.
16931718 crystal structure of a tetrameric exon junction core complex containing the DEAD-box adenosine triphosphatase eukaryotic initiation factor 4AIII bound to an ATP analog, MAGOH, Y14, a fragment of MLN51, and a polyuracil mRNA mimic
15166247 data demonstrate that metastatic lymph node(MLN)51 protein associates with exon junction complex in the nucleus and remains stably associated with messenger RNA in the cytoplasm

AA Sequence

MADRRRQRASQDTEDEESGASGSDSGGSPLRGGGSCSGSAGGGGSGSLPSQRGGRTGALHLRRVESGGAK      1 - 70
SAEESECESEDGIEGDAVLSDYESAEDSEGEEGEYSEEENSKVELKSEANDAVNSSTKEEKGEEKPDTKS     71 - 140
TVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLRGQTQEEEVRPKGRQRK    141 - 210
LWKDEGRWEHDKFREDEQAPKSRQELIALYGYDIRSAHNPDDIKPRRIRKPRYGSPPQRDPNWNGERLNK    211 - 280
SHRHQGLGGTLPPRTFINRNAAGTGRMSAPRNYSRSGGFKEGRAGFRPVEAGGQHGGRSGETVKHEISYR    281 - 350
SRRLEQTSVRDPSPEADAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKL    351 - 420
AEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLNIAEQNWSPGQPSFLQPRELR    421 - 490
GMPNHIHMGAGPPPQFNRMEEMGVQGGRAKRYSSQRQRPVPEPPAPPVHISIMEGHYYDPLQFQGPIYTH    491 - 560
GDSPAPLPPQGMLVQPGMNLPHPGLHPHQTPAPLPNPGLYPPPVSMSPGQPPPQQLLAPTYFSAPGVMNF    561 - 630
GNPSYPYAPGALPPPPPPHLYPNTQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSR    631 - 700
GSS                                                                       701 - 703
//

Text Mined References (39)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23530232 2013 EJC core component MLN51 interacts with eIF3 and activates translation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23084401 2012 The cellular EJC interactome reveals higher-order mRNP structure and an EJC-SR protein nexus.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21478859 2011 RNF146 is a poly(ADP-ribose)-directed E3 ligase that regulates axin degradation and Wnt signalling.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21327427 2011 Metastatic lymph node 51 and fibroblast-like synoviocyte hyperproliferation in rheumatoid arthritis pathogenesis.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19410547 2009 Disassembly of exon junction complexes by PYM.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19033377 2009 Mechanism of ATP turnover inhibition in the EJC.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18332872 2008 Genomic analysis of the HER2/TOP2A amplicon in breast cancer and breast cancer cell lines.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17652158 2007 The exon-junction-complex-component metastatic lymph node 51 functions in stress-granule assembly.
17375189 2007 MLN51 stimulates the RNA-helicase activity of eIF4AIII.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16931718 2006 Structure of the exon junction core complex with a trapped DEAD-box ATPase bound to RNA.
16923391 2006 The crystal structure of the exon junction complex reveals how it maintains a stable grip on mRNA.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16601204 2006 Functions of hUpf3a and hUpf3b in nonsense-mediated mRNA decay and translation.
16495234 2006 Mutational analysis of human eIF4AIII identifies regions necessary for exon junction complex formation and nonsense-mediated mRNA decay.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314458 2005 Biochemical analysis of the EJC reveals two new factors and a stable tetrameric protein core.
16209946 2005 Exon-junction complex components specify distinct routes of nonsense-mediated mRNA decay with differential cofactor requirements.
16170325 2005 The exon junction core complex is locked onto RNA by inhibition of eIF4AIII ATPase activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15166247 2004 Association of the breast cancer protein MLN51 with the exon junction complex via its speckle localizer and RNA binding module.
14973490 2004 An eIF4AIII-containing complex required for mRNA localization and nonsense-mediated mRNA decay.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12843282 2003 Barentsz, a new component of the Staufen-containing ribonucleoprotein particles in mammalian cells, interacts with Staufen in an RNA-dependent manner.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12080473 2002 Metastatic Lymph Node 51, a novel nucleo-cytoplasmic protein overexpressed in breast cancer.
11980659 2002 Targets of gene amplification and overexpression at 17q in gastric cancer.
7490069 1995 Identification of four novel human genes amplified and overexpressed in breast carcinoma and localized to the q11-q21.3 region of chromosome 17.