Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.77
PubTator Score 6.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Lung Neoplasms 217 0.0 0.0
Disease Target Count P-value
psoriasis 6514 1.2e-26
ependymoma 4559 3.6e-12
lung adenocarcinoma 2627 6.7e-08
osteosarcoma 7766 2.8e-07
nasopharyngeal carcinoma 1024 3.7e-07
Endometriosis 521 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Kidney cancer 2548 0.0 0.5
Disease Target Count Z-score Confidence
Lung adenoma 8 5.684 2.8

Expression

  Differential Expression (6)

Disease log2 FC p
Endometriosis -1.113 1.6e-02
ependymoma 3.000 3.6e-12
lung adenocarcinoma -1.100 6.7e-08
nasopharyngeal carcinoma -2.800 3.7e-07
osteosarcoma -1.512 2.8e-07
psoriasis -1.400 1.2e-26

Synonym

Accession Q6TDU7 B4DNP2 F5H6T6 Q17RL2 Q4G171 Q5U5K5 Q9NV50
Symbols LAS1
PPP1R54

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MSGSKKKKVTKAERLKLLQEEEERRLKEEEEARLKYEKEEMERLEIQRIEKEKWHRLEAKDLERRNEELE      1 - 70
ELYLLERCFPEAEKLKQETKLLSQWKHYIQCDGSPDPSVAQEMNTFISLWKEKTNETFEEVIEKSKVVLN     71 - 140
LIEKLKFILLETPPCDLQDKNIIQYQESILQLQELLHLKFGVATEILLKQASTLADLDSGNMEKVIKDEN    141 - 210
VTLYVWANLKKNPRHRSVRFSETQIGFEIPRILATSDIAVRLLHTHYDHVSALHPVSTPSKEYTSAVTEL    211 - 280
VKDDVKNVEKAISKEVEEESKQQERGSHLIQEEEIKVEEEQGDIEVKMSSAEEESEAIKCEREMKVLSET    281 - 350
VSAAQLLLVENSSEKPDFFEDNVVDLCQFTTLGGVYHLDILELPPQCKPVKGWMIVEILKEGLQKYTYPP    351 - 420
ETTEEFETENAFPPIEVTLEVHENVIFFEDPVVVRWDAEGKHWRTDGISNVSYKPKERLVTFSLDTFGPV    421 - 490
TLIQDAHINMPYQSWELRPLDVNKVLLTVTTVFTEIQIQIKENLCMLSSIKLKDKKHISILEGTWMTPIP    491 - 560
FIIALKEAGLNIFPTRHSHFYVIINNKVPLVEVKAYRQMALLSSAFAFGWSKWNLLCNSTKVVFKVREHL    561 - 630
TEACTENPNWALLMFSGDRAQRLKIKEESEAFSEALKEETEFHSTLYHMVKDFASEEAMEKVRSSNCQFV    631 - 700
NSVCHMLLSTRLLSYS                                                          701 - 716
//

Text Mined References (11)

PMID Year Title