Property Summary

NCBI Gene PubMed Count 21
PubMed Score 954.74
PubTator Score 99.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
chronic rhinosinusitis -1.052 2.9e-02
dermatomyositis 1.800 1.1e-03
glioblastoma 1.300 1.5e-02
juvenile dermatomyositis 1.605 4.0e-15
medulloblastoma, large-cell 1.300 6.4e-03
non primary Sjogren syndrome sicca 1.100 2.1e-02
osteosarcoma 1.183 1.9e-03
ovarian cancer 1.100 1.4e-04
pediatric high grade glioma 1.100 1.1e-02
psoriasis 2.000 4.2e-05

Gene RIF (8)

AA Sequence

MADSSGQQGKGRRVQPQWSPPAGTQPCRLHLYNSLTRNKEVFIPQDGKKVTWYCCGPTVYDASHMGHARS      1 - 70
YISFDILRRVLKDYFKFDVFYCMNITDIDDKIIKRARQNHLFEQYREKRPEAAQLLEDVQAALKPFSVKL     71 - 140
NETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNS    141 - 210
IFSKLPKFWEGDFHRDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGYGYVSNGSVYFDTAKFASSEK    211 - 280
HSYGKLVPEAVGDQKALQEGEGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPWGKGRPGWHIECSA    281 - 350
MAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHTGHLTIAGCKMSKSLKNFITIKDA    351 - 420
LKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEKFLNEFFLNVKDILRAPVDITGQFEKWGEEEAEL    421 - 490
NKNFYDKKTAIHKALCDNVDTRTVMEEMRALVSQCNLYMAARKAVRKRPNQALLENIALYLTHMLKIFGA    491 - 560
VEEDSSLGFPVGGPGTSLSLEATVMPYLQVLSEFREGVRKIAREQKVPEILQLSDALRDNILPELGVRFE    561 - 630
DHEGLPTVVKLVDRNTLLKEREEKRRVEEEKRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSK    631 - 700
FDENGLPTHDMEGKELSKGQAKKLKKLFEAQEKLYKEYLQMAQNGSFQ                          701 - 748
//

Text Mined References (30)

PMID Year Title