Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.21
PubTator Score 1.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -1.400 5.8e-08
Astrocytoma, Pilocytic -1.600 4.6e-03
atypical teratoid/rhabdoid tumor -2.000 2.7e-04
ependymoma -2.300 1.3e-08
gastric carcinoma -2.300 1.0e-02
glioblastoma -1.400 8.5e-03
group 3 medulloblastoma -3.300 3.0e-03
oligodendroglioma -1.600 2.1e-07
pediatric high grade glioma -1.800 2.0e-03
Pick disease -2.100 1.3e-03
primitive neuroectodermal tumor -1.500 3.0e-02
progressive supranuclear palsy -2.100 1.8e-02
subependymal giant cell astrocytoma -3.764 2.5e-03

Gene RIF (2)

AA Sequence

MLLCLSPAWLMKVPAPGQPGEAALLVSKAVSFHPGGLTFLDDFVPPRRATYFLAGLGLGPGRGREAAELA      1 - 70
RDLTCPTGASAELARLLEDRLLTRQLLAQQGGVAVPATLAFTYKPPGLLRGGDASLGLRLVELSGKEGQE     71 - 140
TLVKEEVEAFLRSEALGDILQVAVKLSGWRWRGRQAWRLHPRAELGAVVDTVLALLEKLEEEESVLVEAV    141 - 210
YPPAQLPCSDGPSPGPGLAVRICAVVCRTQGDRPLLSKVVCGVGRGDRPLRHHNSLPRTLEVALAQCGLG    211 - 280
EEAQVAAVRQRVKAAAEAALAAVLALEAGLSAEQRGGRRAHTDFLGVDFALTAAGGVLTPVALELNGGLC    281 - 350
LEACGALEGLWAAPRLGPAADEAVAAPLVETMLRRSARCLMEGKQLLVVGAGGVSKKFVWEAARDYGLQL    351 - 420
HLVESDPNHFASQLVQTFIHFDMTEHRRDEENARLLAELVRARGLKLDGCFSYWDDCLVLTALLCQELGL    421 - 490
PCSSPAAMRLAKQKSLTQLHLLHHHGPPWPAPSLHAVPCCPLESEADVERAVHQVPLPGVMKLEFGAGAV    491 - 560
GVRLVEDAPQCHEHFSRITRDLQGEADHPGIGLGWGNAMLLMEFVEGTEHDVDLVLFGGRLLAAFVSDNG    561 - 630
PTRLPGFTETAACMPTGLAPEQEAQMVQAAFRCCLGCGLLDGVFNVELKLTGAGPRLIEINPRMGGFYLR    631 - 700
DWILELYGVDLLLAAVMVACGLRPALPTRPRARGHLVGVMCLVSQHLQALSSTASRETLQALHDRGLLRL    701 - 770
NLLEEALVPGEYEEPYCSVACAGPSPTEARLRLLGLCQGLGIDGPSYPVAHFLSHFK                 771 - 827
//

Text Mined References (8)

PMID Year Title