Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.92
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.1e-05
gastric cancer 459 6.6e-04
medulloblastoma, large-cell 6241 5.4e-03
active Crohn's disease 922 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease 1.173 1.7e-02
gastric cancer 1.100 6.6e-04
medulloblastoma, large-cell -1.100 5.4e-03
osteosarcoma -2.348 1.1e-05

AA Sequence

MQRRRRPPPPTSRLPEGCGGGGGGSEEVEVQFSAGRWGSAAAVSAAAAAATRSTEEEEERLEREHFWKII      1 - 70
NAFRYYGTSMHERVNRTERQFRSLPANQQKLLPQFLLHLDKIRKCIDHNQEILLTIVNDCIHMFENKEYG     71 - 140
EDGNGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYQPIIKEILKNFPKERWDPSKVNILVPGAG    141 - 210
LGRLAWEIAMLGYACQGNEWSFFMLFSSNFVLNRCSEINKYKLYPWIHQFSNNRRSADQIRPIFFPDVDP    211 - 280
HSLPPGSNFSMTAGDFQEIYSECNTWDCIATCFFIDTAHNVIDYIDTIWKILKPGGIWINLGPLLYHFEN    281 - 350
LANELSIELSYEDIKNVVLQYGFKVEVEKESVLSTYTVNDLSMMKYYYECVLFVVRKPQ               351 - 409
//

Text Mined References (9)

PMID Year Title