Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.86
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.1e-05
gastric cancer 436 6.6e-04
medulloblastoma, large-cell 6234 5.4e-03
active Crohn's disease 918 1.7e-02
Disease Target Count Z-score Confidence
Focal epilepsy 5 3.002 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
gastric cancer 1.100 6.6e-04
osteosarcoma -2.348 1.1e-05
medulloblastoma, large-cell -1.100 5.4e-03
active Crohn's disease 1.173 1.7e-02

Synonym

Accession Q8N4J0 Q7Z383 Q8N7C5
Symbols C9orf41
UPF0586

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MQRRRRPPPPTSRLPEGCGGGGGGSEEVEVQFSAGRWGSAAAVSAAAAAATRSTEEEEERLEREHFWKII      1 - 70
NAFRYYGTSMHERVNRTERQFRSLPANQQKLLPQFLLHLDKIRKCIDHNQEILLTIVNDCIHMFENKEYG     71 - 140
EDGNGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYQPIIKEILKNFPKERWDPSKVNILVPGAG    141 - 210
LGRLAWEIAMLGYACQGNEWSFFMLFSSNFVLNRCSEINKYKLYPWIHQFSNNRRSADQIRPIFFPDVDP    211 - 280
HSLPPGSNFSMTAGDFQEIYSECNTWDCIATCFFIDTAHNVIDYIDTIWKILKPGGIWINLGPLLYHFEN    281 - 350
LANELSIELSYEDIKNVVLQYGFKVEVEKESVLSTYTVNDLSMMKYYYECVLFVVRKPQ               351 - 409
//

Text Mined References (9)

PMID Year Title
26001783 2015 UPF0586 Protein C9orf41 Homolog Is Anserine-producing Methyltransferase.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.