Property Summary

NCBI Gene PubMed Count 25
PubMed Score 23.00
PubTator Score 18.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis -1.100 7.1e-03
malignant mesothelioma -2.300 2.3e-07
astrocytic glioma -1.600 1.6e-02
oligodendroglioma -1.200 4.9e-02
psoriasis -1.100 9.9e-04
osteosarcoma -1.728 1.5e-05
glioblastoma -1.100 2.5e-03
atypical teratoid / rhabdoid tumor -1.300 2.9e-03
medulloblastoma, large-cell -1.900 7.2e-05
primitive neuroectodermal tumor -1.900 8.7e-04
group 4 medulloblastoma -1.900 6.3e-07
pilocytic astrocytoma -1.800 7.1e-07
acute myeloid leukemia -1.300 3.4e-02
ovarian cancer -1.400 1.0e-05
pituitary cancer 1.100 3.0e-03

 GO Function (1)

 MGI Phenotype (1)

Pathway (1)

Gene RIF (13)

PMID Text
25254322 LRRC16A plays a role in adult respiratory distress syndrome pathophysiology by interacting with, and being mediated through, platelets.
24318514 shown for the first time that CARMIL/LRRC16A was associated with gout, which could be due to urate transportsome failure
23904264 The results also suggest that the ability of CARMIL1 to inhibit CP in cells may be regulated.
22411988 Data suggest that CARMIL promotes uncapping by binding to a freely accessible site on Capping protein (CP) bound to a filament barbed end and inducing a change in the conformation of the actin-binding surface of CP.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20162743 Observational study of gene-disease association. (HuGE Navigator)
20162742 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19890391 Observational study of gene-disease association. (HuGE Navigator)
19861489 Observational study of gene-disease association. (HuGE Navigator)
19846667 The two CARMIL isoforms are both important for cell migration, but they have distinct functions.[CARMIL1, CARMIL2]
19503597 Meta-analysis of gene-disease association. (HuGE Navigator)
19460752 Knockdown of leucine rich repeat containing 16A (LRRC16A) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MTEESSDVPRELIESIKDVIGRKIKISVKKKVKLEVKGDKVENKVLVLTSCRAFLVTARIPTKLELTFSY      1 - 70
LEIHGVVCSKSAQMIVETEKCSISMKMASPEDVSEVLAHIGTCLRKIFPGLSPVRIMKKVSMEPSERLAS     71 - 140
LQALWDSQTVAEQGPCGGFSQMYACVCDWLGFSYREEVQWDVDTIYLTQDTRELNLQDFSHLDHRDLIPI    141 - 210
IAALEYNQWFTKLSSKDLKLSTDVCEQILRVVSRSNRLEELVLENAGLRTDFAQKLASALAHNPNSGLHT    211 - 280
INLAGNPLEDRGVSSLSIQFAKLPKGLKHLNLSKTSLSPKGVNSLSQSLSANPLTASTLVHLDLSGNVLR    281 - 350
GDDLSHMYNFLAQPNAIVHLDLSNTECSLDMVCGALLRGCLQYLAVLNLSRTVFSHRKGKEVPPSFKQFF    351 - 420
SSSLALMHINLSGTKLSPEPLKALLLGLACNHNLKGVSLDLSNCELRSGGAQVLEGCIAEIHNITSLDIS    421 - 490
DNGLESDLSTLIVWLSKNRSIQHLALGKNFNNMKSKNLTPVLDNLVQMIQDEESPLQSLSLADSKLKTEV    491 - 560
TIIINALGSNTSLTKVDISGNGMGDMGAKMLAKALQINTKLRTVIWDKNNITAQGFQDIAVAMEKNYTLR    561 - 630
FMPIPMYDASQALKTNPEKTEDALQKIENYLLRNHETRKYLQEQAYRLQQGIVTSTTQQMIDRICVKVQD    631 - 700
HLNSLRNCGGDAIQEDLKSAERLMRDAKNSKTLLPNLYHVGGASWAGASGLLSSPIQETLESMAGEVTRV    701 - 770
VDEQLKALLESMVDAAENLCPNVMKKAHIRQDLIHASTEKISIPRTFVKNVLLEQSGIDILNKISEVKLT    771 - 840
VASFLSDRIVDEILDALSHCHHKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEELTEIERLEDL    841 - 910
DTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDLDKALEEVPIHIEDPPFPSLRQEKRSSGFISELPSEEGK    911 - 980
KLEHFTKLRPKRNKKQQPTQAAVCAANIVSQDGEQNGLMGRVDEGVDEFFTKKVTKMDSKKWSTRGSESH    981 - 1050
ELNEGGDEKKKRDSRKSSGFLNLIKSRSKSERPPTILMTEEPSSPKGAVRSPPVDCPRKDTKAAEHNGNS   1051 - 1120
ERIEEIKTPDSFEESQGEEIGKVERSDSKSSPQAGRRYGVQVMGSGLLAEMKAKQEKRAACAQKKLGNDA   1121 - 1190
VSQDSSSPALSGVERSDGGGAVPKLHPGLPENRFGLGTPEKNTKAEPKAEAGSRSRSSSSTPTSPKPLLQ   1191 - 1260
SPKPSLAARPVIPQKPRTASRPDDIPDSPSSPKVALLPPVLKKVPSDKERDGQSSPQPSPRTFSQEVSRR   1261 - 1330
SWGQQAQEYQEQKQRSSSKDGHQGSKSNDSGEEAEKEFIFV                                1331 - 1371
//

Text Mined References (36)

PMID Year Title
26578515 2016 Cell Migration and Invadopodia Formation Require a Membrane-binding Domain of CARMIL2.
25254322 2015 Platelet count mediates the contribution of a genetic variant in LRRC16A to ARDS risk.
24318514 2014 Common variant of leucine-rich repeat-containing 16A (LRRC16A) gene is associated with gout susceptibility.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23904264 2013 Physiological role of the interaction between CARMIL1 and capping protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22423221 2012 A meta-analysis and genome-wide association study of platelet count and mean platelet volume in african americans.
22411988 2012 Mechanism for CARMIL protein inhibition of heterodimeric actin-capping protein.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20162743 2010 Common variants in SLC17A3 gene affect intra-personal variation in serum uric acid levels in longitudinal time series.
20162742 2010 Predictive value of 8 genetic loci for serum uric acid concentration.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19890391 2009 Common polymorphisms influencing serum uric acid levels contribute to susceptibility to gout, but not to coronary artery disease.
19861489 2010 Replication of the five novel loci for uric acid concentrations and potential mediating mechanisms.
19846667 2009 Distinct roles for CARMIL isoforms in cell migration.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19503597 2009 Meta-analysis of 28,141 individuals identifies common variants within five new loci that influence uric acid concentrations.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19084217 2009 Variants in TF and HFE explain approximately 40% of genetic variation in serum-transferrin levels.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16054028 2005 Mammalian CARMIL inhibits actin filament capping by capping protein.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.