Property Summary

Ligand Count 38
NCBI Gene PubMed Count 94
PubMed Score 130.81
PubTator Score 113.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
psoriasis 6694 0.0 2.41431573993303E-5
Disease Target Count P-value
non-small cell lung cancer 2890 1.4e-15
ovarian cancer 8520 3.3e-06
osteosarcoma 7950 6.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 3.302 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.300 2.4e-05
non-small cell lung cancer 1.001 1.4e-15
osteosarcoma -1.527 6.1e-03
ovarian cancer 1.400 3.3e-06

PDB (10)

Gene RIF (59)

AA Sequence

MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDSAGIA      1 - 70
LYSHEDVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSFYNILKTCRGHTLERSVFSER     71 - 140
TEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKI    141 - 210
YAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLK    211 - 280
PSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMA    281 - 350
KSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRC    351 - 420
LFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPPGSHYT    421 - 490
SPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMSTGIV    491 - 560
QGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNTMHYGS                          561 - 608
//

Text Mined References (100)

PMID Year Title