Property Summary

NCBI Gene PubMed Count 88
PubMed Score 118.44
PubTator Score 113.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
psoriasis 6685
Disease Target Count P-value
non-small cell lung cancer 2798 1.4e-15
ovarian cancer 8491 3.3e-06
osteosarcoma 7933 6.1e-03
Disease Target Count Z-score Confidence
Cancer 2346 3.187 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.300 2.4e-05
osteosarcoma -1.527 6.1e-03
non-small cell lung cancer 1.001 1.4e-15
ovarian cancer 1.400 3.3e-06

Protein-protein Interaction (3)

Gene RIF (54)

PMID Text
26848779 Monitoring of the CARM1-dependent production of monomethylated and dimethylated peptides over time by self-assembled monolayer and matrix-assisted laser desorption ionization mass spectrometry revealed that methylation by CARM1 is distributive.
26656492 CARM1 associates with major nonsense-mediated mRNA decay factor UPF1 and promotes its occupancy on premature terminating codon-containing transcripts in spinal muscular atrophy.
26030442 no obvious association of CARM1 isoform expression and clinical correlates in breast cancer
25934150 Like insulin, CARM1 overexpression increased CDK2 and CDK4 expression. In addition, CARM1 knockdown reduced the number of insulin-induced G2/M phase cells
25792598 disruption of CARM1 enhances the nuclear retention of mRNAs containing IRAlus
25585345 O-GlcNAcylation of CARM1 at its C-terminus is an important determinant for CARM1 substrate specificity.
25392304 Data indicate that coactivator-associated arginine methyltransferase 1 (CARM1) regulates neural differentiation through Nanog homeobox protein and microRNA miR92a.
25348716 PRMT4 has a role in arginine methylation, which negatively regulates retinoblastoma tumor suppressor protein and promotes E2F-1 dissociation
25072916 high-glucose-induced CARM1 expression increases RPE cell apoptosis via H3R17 asymmetric dimethylation
25064859 a noncoding variant in the CARM1-promoter functions as a regulator of gene transcription and homocysteine levels
24530761 PBMCs from patients with ACS showed higher levels of CARM1 mRNA and protein expression.CARM1 regulated the transcription of IP-10, IL-8, and MCP-1. miR-15a modulated CARM1 expression through targeted binding to CARM1 3'-UTR.
24434208 we identify BAF155 as a substrate for arginine methyltransferase CARM1.
24332853 Overexpression of PRMT4 represses miR-223 via methylation of RUNX1 and blocks myeloid differentiation.
24211191 CARM1 and PRMT1 are dysregulated in lung cancer; only CARM1 expression was found to be correlated with tumor differentiation and neither CARM1 nor PRMT1 expression was correlated with survival.
23980157 Arginine 42 of histone H3 (H3R42), is dimethylated by the methyltransferases coactivator arginine methyltransferase 1 (CARM1) and protein arginine methyltransferase 6 (PRMT6) in vitro and in vivo.
23915145 CARM1 overexpression was associated with poorly characterized clinicopathologic parameters and HER2 overexpression in invasive breast cancer.
23887673 CARM1 could be a potential marker of luminal class subclassification and for target therapy, particularly in the ER-positive luminal-like subgroup.
23837869 CARM1 represses replicative senescence by methylating HuR.
23699174 Data show the transcriptional regulation of the human ferritin gene by coordinated regulation of Nrf2 and protein arginine methyltransferases PRMT1 and PRMT4.
23663560 increased cytoplasmic CARM1, relative to nuclear levels, appear to be associated with self-identified African ethnicity and this result is being further investigated using quantified genetic ancestry measures.
23505388 These findings reveal an important and so far unknown connection between PRMT4 and the chromatin remodeller Mi2 in c-Myb signalling.
23486015 Inhibition of CARM1 decreases PELP1 oncogenic activity.
23301034 the miR-181c-CARM1 pathway has an important role in regulating the differentiation of human embryonic stem cells
23265702 Findings indicate that expression of PRMT4/CARM1 and PRMT6 is deregulated in melanoma.
22190034 HIV-1 PR is identified to have a physical interaction with coactivator-associated arginine methyltransferase 1 (CARM1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22046437 found that CARM1 facilitates Sox2-mediated transactivation and directly methylates Sox2 at arginine 113
21478268 A coactivator role of CARM1 in the dysregulation of beta-catenin activity in colorectal cancer cell growth and gene expression
21445011 Signal transduction in cell death and survival involves a role for CARM1 in arginine methylation.
21282336 Findings suggest that coexpression of CARM1 and ERalpha may provide a better biomarker of well-differentiated breast cancer.
20932315 Observational study of gene-disease association. (HuGE Navigator)
20462455 CARM1 was particularly overexpressed in colorectal cancers while CARM1 expression was not prevalent in prostate and breast cancers.
20360387 phosphorylation of CARM1 by PKA at a single serine is necessary and sufficient for direct binding to the unliganded hormone-binding domain of ERalpha, and the interaction is necessary for cAMP activation of ERalpha
20213728 The physical interaction of CARM1 and PCAF is likely pivotal for the activation of PCAF in the downstream of CARM1 pathway for inducing myogenin under Tetradecanoylphorbol Acetate -induced differentiation.
19725955 These results establish a role for CARM1 as an important regulator of chondrocyte proliferation during embryogenesis.
19183483 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18172323 CARM1 is a critical factor in the pathway of estrogen-stimulated breast cancer growth downstream of ERA and AIB1and upstream of the cell cycle regulatory transcription factor E2F1.
17882262 the N-terminal and the C-terminal end of CARM1 catalytic module contain molecular switches that may determine how CARM1 regulates its biological activities by protein-protein interactions
17640894 phosphorylation of CARM1 serves as a unique mechanism for inactivating CARM1-regulated estrogen-dependent gene expression
17218272 The identification of splicing factors that are methylated by CARM1, and protein-protein interactions that are regulated by CARM1, strongly implicates this enzyme in the regulation of alternative splicing.
17043108 p/CIP/SRC-3 activity and stability are regulated by CARM1-dependent methylation
17005681 our data provide evidence that CARM1 enhances Tax transactivation of the HTLV-1 LTR through a direct interaction between CARM1 and Tax and this binding promotes methylation of histone H3
16923966 Results suggest that members of the SRC coactivator family, such as SRC-3, serve as substrates for the enzymatic coactivator coactivator-associated arginine methyltransferase 1 (CARM1).
16705743 CARM1 is essential for androgen receptor (AR) function and may play a role in prostate cancer progression.
16497732 CARM1 participates in NF-kappaB-mediated transcription through H3-R17 methylation and support a nonnuclear receptor-associated function for CARM1.
16330542 CARM1 has a role in signal-dependent control of gluconeogenic key enzyme genes
16254053 arginine methylation of CBP is required for IFN-gamma induction of MHC-II. A kinetic analysis shows that CIITA, CARM1, and H3-R17 methylation all precede CBP loading on the MHC-II promoter during IFN-gamma treatment.
15944154 CARM1 affects pre-mRNA splicing in an isoform-specific manner
15616592 results show that CARM1/PRMT4 is a novel transcriptional coactivator of NF-kappaB and functions as a promoter-specific regulator of NF-kappaB recruitment to chromatin
15221992 overexpression of CARM1 is involved in the development of prostate carcinoma
15096520 CARM1 plays a significant role in promoting the differentiation of early thymocyte progenitors, possibly through its direct action on TARPP.
12498683 The CBP/p300 acetylase and the CARM1 methyltransferase can positively regulate the expression of estrogen-responsive genes, there is a crosstalk between lysine acetylation and arginine methylation on chromatin
11850402 Methylates PAB1 and TARPP, suggesting a role in regulating transcription/translation.

AA Sequence

MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDSAGIA      1 - 70
LYSHEDVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSFYNILKTCRGHTLERSVFSER     71 - 140
TEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKI    141 - 210
YAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLK    211 - 280
PSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMA    281 - 350
KSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRC    351 - 420
LFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPPGSHYT    421 - 490
SPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMSTGIV    491 - 560
QGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNTMHYGS                          561 - 608
//

Text Mined References (94)

PMID Year Title
26848779 2016 CARM1 Preferentially Methylates H3R17 over H3R26 through a Random Kinetic Mechanism.
26656492 2016 A novel role for CARM1 in promoting nonsense-mediated mRNA decay: potential implications for spinal muscular atrophy.
26267537 2015 Characterization of a Steroid Receptor Coactivator Small Molecule Stimulator that Overstimulates Cancer Cells and Leads to Cell Stress and Death.
26030442 2015 Differential CARM1 Isoform Expression in Subcellular Compartments and among Malignant and Benign Breast Tumors.
25934150 2015 Insulin-induced CARM1 upregulation facilitates hepatocyte proliferation.
25792598 2015 Protein arginine methyltransferase CARM1 attenuates the paraspeckle-mediated nuclear retention of mRNAs containing IRAlus.
25585345 2015 O-GlcNAcylation of co-activator-associated arginine methyltransferase 1 regulates its protein substrate specificity.
25392304 2015 CARM1 regulates astroglial lineage through transcriptional regulation of Nanog and posttranscriptional regulation by miR92a.
25348716 2015 PRMT4-mediated arginine methylation negatively regulates retinoblastoma tumor suppressor protein and promotes E2F-1 dissociation.
25072916 2014 High-glucose-induced CARM1 expression regulates apoptosis of human retinal pigment epithelial cells via histone 3 arginine 17 dimethylation: role in diabetic retinopathy.
25064859 2014 Functional analysis of single-nucleotide polymorphisms in the regulation of coactivator-associated arginine methyltransferase 1 expression and plasma homocysteine levels.
24530761 2014 Coactivator-associated arginine methyltransferase 1 targeted by miR-15a regulates inflammation in acute coronary syndrome.
24434208 2014 CARM1 methylates chromatin remodeling factor BAF155 to enhance tumor progression and metastasis.
24332853 2013 PRMT4 blocks myeloid differentiation by assembling a methyl-RUNX1-dependent repressor complex.
24211191 2014 CARM1 and PRMT1 are dysregulated in lung cancer without hierarchical features.
23980157 2013 H3R42me2a is a histone modification with positive transcriptional effects.
23915145 2013 Overexpression of CARM1 in breast cancer is correlated with poorly characterized clinicopathologic parameters and molecular subtypes.
23887673 2013 The oestrogen receptor coactivator CARM1 has an oncogenic effect and is associated with poor prognosis in breast cancer.
23837869 2013 Loss of CARM1 is linked to reduced HuR function in replicative senescence.
23699174 2013 Transcriptional regulation of the human ferritin gene by coordinated regulation of Nrf2 and protein arginine methyltransferases PRMT1 and PRMT4.
23663560 2013 Expression and sub-cellular localization of an epigenetic regulator, co-activator arginine methyltransferase 1 (CARM1), is associated with specific breast cancer subtypes and ethnicity.
23505388 2013 PRMT4 is a novel coactivator of c-Myb-dependent transcription in haematopoietic cell lines.
23486015 2013 PELP1 oncogenic functions involve CARM1 regulation.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23434684 2013 ?-Estradiol-dependent activation of the JAK/STAT pathway requires p/CIP and CARM1.
23301034 2013 MicroRNA-181 regulates CARM1 and histone arginine methylation to promote differentiation of human embryonic stem cells.
23265702 2013 Deregulation of protein methylation in melanoma.
22863532 2012 Carm1 regulates Pax7 transcriptional activity through MLL1/2 recruitment during asymmetric satellite stem cell divisions.
22723830 2012 A role for CARM1-mediated histone H3 arginine methylation in protecting histone acetylation by releasing corepressors from chromatin.
22428544 2012 CARM1/PRMT4 is necessary for the glycogen gene expression programme in skeletal muscle cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22046437 2011 CARM1 mediates modulation of Sox2.
21952734 2011 Small molecule inhibitors that discriminate between protein arginine N-methyltransferases PRMT1 and CARM1.
21478268 2011 A coactivator role of CARM1 in the dysregulation of ?-catenin activity in colorectal cancer cell growth and gene expression.
21445011 2011 Roles of protein arginine methylation in DNA damage signaling pathways is CARM1 a life-or-death decision point?
21410432 2011 Structural basis for CARM1 inhibition by indole and pyrazole inhibitors.
21282336 2011 CARM1 is an important determinant of ER?-dependent breast cancer cell differentiation and proliferation in breast cancer cells.
21269460 2011 Initial characterization of the human central proteome.
21138967 2011 Automethylation of CARM1 allows coupling of transcription and mRNA splicing.
21126607 2011 Expression and purification of full-length mouse CARM1 from transiently transfected HEK293T cells using HaloTag technology.
20932315 2010 Genes encoding critical transcriptional activators for murine neural tube development and human spina bifida: a case-control study.
20462455 2010 Differential CARM1 expression in prostate and colorectal cancers.
20360387 2010 CARM1 mediates the ligand-independent and tamoxifen-resistant activation of the estrogen receptor alpha by cAMP.
20213728 2010 CARM1 activates myogenin gene via PCAF in the early differentiation of TPA-induced rhabdomyosarcoma-derived cells.
20111005 2010 Crosstalk between C/EBPbeta phosphorylation, arginine methylation, and SWI/SNF/Mediator implies an indexing transcription factor code.
20022955 2010 Identification of a novel inhibitor of coactivator-associated arginine methyltransferase 1 (CARM1)-mediated methylation of histone H3 Arg-17.
19843527 2009 Biochemical control of CARM1 enzymatic activity by phosphorylation.
19725955 2009 Arginine methyltransferase CARM1/PRMT4 regulates endochondral ossification.
19419866 2009 Optimization of pyrazole inhibitors of Coactivator Associated Arginine Methyltransferase 1 (CARM1).
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19405910 2009 Kinetic analysis of human protein arginine N-methyltransferase 2: formation of monomethyl- and asymmetric dimethyl-arginine residues on histone H4.
19183483 2009 Screening and association testing of common coding variation in steroid hormone receptor co-activator and co-repressor genes in relation to breast cancer risk: the Multiethnic Cohort.
19101556 2009 Physical and functional interactions between hnRNP K and PRMT family proteins.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18511550 2008 Dual role of the arginine methyltransferase CARM1 in the regulation of c-Fos target genes.
18495660 2008 Promiscuous modification of the nuclear poly(A)-binding protein by multiple protein-arginine methyltransferases does not affect the aggregation behavior.
18413343 2008 The protein arginine methyltransferases CARM1 and PRMT1 cooperate in gene regulation.
18280497 2008 Protein arginine methyltransferase 1 coactivates NF-kappaB-dependent gene expression synergistically with CARM1 and PARP1.
18172323 2008 CARM1 regulates estrogen-stimulated breast cancer growth through up-regulation of E2F1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17934343 2007 The functional role of the CARM1-SNF5 complex and its associated HMT activity in transcriptional activation by thyroid hormone receptor.
17898714 2007 Methylation of histone H3R2 by PRMT6 and H3K4 by an MLL complex are mutually exclusive.
17882262 2007 Functional insights from structures of coactivator-associated arginine methyltransferase 1 domains.
17640894 2007 Phosphorylation-mediated inactivation of coactivator-associated arginine methyltransferase 1.
17218272 2007 The arginine methyltransferase CARM1 regulates the coupling of transcription and mRNA processing.
17043108 2007 The activity and stability of the transcriptional coactivator p/CIP/SRC-3 are regulated by CARM1-dependent methylation.
17005681 2006 Coactivator-associated arginine methyltransferase 1 enhances transcriptional activity of the human T-cell lymphotropic virus type 1 long terminal repeat through direct interaction with Tax.
16923966 2006 Signaling within a coactivator complex: methylation of SRC-3/AIB1 is a molecular switch for complex disassembly.
16705743 2006 Involvement of arginine methyltransferase CARM1 in androgen receptor function and prostate cancer cell viability.
16508003 2006 CARM1 regulates proliferation of PC12 cells by methylating HuD.
16497732 2006 Coactivator-associated arginine methyltransferase-1 enhances nuclear factor-kappaB-mediated gene transcription through methylation of histone H3 at arginine 17.
16344550 2006 Differential use of functional domains by coiled-coil coactivator in its synergistic coactivator function with beta-catenin or GRIP1.
16330542 2006 Signal-dependent control of gluconeogenic key enzyme genes through coactivator-associated arginine methyltransferase 1.
16254053 2005 Interplay among coactivator-associated arginine methyltransferase 1, CBP, and CIITA in IFN-gamma-inducible MHC-II gene expression.
15944154 2005 Coactivator-associated arginine methyltransferase 1, CARM1, affects pre-mRNA splicing in an isoform-specific manner.
15731352 2005 Regulation of coactivator complex assembly and function by protein arginine methylation and demethylimination.
15616592 2005 Arginine methyltransferase CARM1 is a promoter-specific regulator of NF-kappaB-dependent gene expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471871 2004 Ligand-dependent activation of the farnesoid X-receptor directs arginine methylation of histone H3 by CARM1.
15221992 2004 Aberrant expression of CARM1, a transcriptional coactivator of androgen receptor, in the development of prostate carcinoma and androgen-independent status.
15096520 2004 Loss of CARM1 results in hypomethylation of thymocyte cyclic AMP-regulated phosphoprotein and deregulated early T cell development.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14500758 2003 SNF2-related CBP activator protein (SRCAP) functions as a coactivator of steroid receptor-mediated transcription through synergistic interactions with CARM-1 and GRIP-1.
12498683 2002 Crosstalk between CARM1 methylation and CBP acetylation on histone H3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12374746 2002 Control of CBP co-activating activity by arginine methylation.
12237300 2002 Lipopolysaccharide-induced methylation of HuR, an mRNA-stabilizing protein, by CARM1. Coactivator-associated arginine methyltransferase.
11850402 2002 PABP1 identified as an arginine methyltransferase substrate using high-density protein arrays.
11751582 2002 Methylation at arginine 17 of histone H3 is linked to gene activation.
11724789 2002 The novel human protein arginine N-methyltransferase PRMT6 is a nuclear enzyme displaying unique substrate specificity.
10381882 1999 Regulation of transcription by a protein methyltransferase.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.