Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.34
PubTator Score 4.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 2.400 7.1e-11
osteosarcoma -1.764 1.8e-05
sonic hedgehog group medulloblastoma 2.200 1.0e-09
glioblastoma 1.100 2.8e-03
primitive neuroectodermal tumor 1.200 3.6e-03
Atopic dermatitis 1.300 6.8e-04

Synonym

Accession Q9Y2V2 B2R4C3 D3DUF5 Q2YDX5 Q9BQ53
Symbols CSDC1
CRHSP24
CRHSP-24

Gene

PDB

3AQQ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
21990353 CARHSP1 inhibits hepatic gluconeogenic gene expression via repression of PPARalpha
21177848 CRHSP-24 participates in oxidative stress response via a dynamic and temporal association between stress granules and processing bodies.
21078874 Data suggest that CARHSP1 is a TNF-alpha mRNA stability enhancer required for effective TNF-alpha production, demonstrating the importance of both stabilization and destabilization pathways in regulating the TNF-alpha mRNA half-life.

AA Sequence

MSSEPPPPPQPPTHQASVGLLDTPRSRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKGVCKCF      1 - 70
CRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETW     71 - 140
SGHVISS                                                                   141 - 147
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21990353 2011 Inhibition of gluconeogenic genes by calcium-regulated heat-stable protein 1 via repression of peroxisome proliferator-activated receptor ?.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21177848 2011 Structure-functional analyses of CRHSP-24 plasticity and dynamics in oxidative stress response.
21078874 2011 CARHSP1 is required for effective tumor necrosis factor alpha mRNA stabilization and localizes to processing bodies and exosomes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18088087 2008 Phosphoproteome of resting human platelets.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15910284 2005 Identification of calcium-regulated heat-stable protein of 24 kDa (CRHSP24) as a physiological substrate for PKB and RSK using KESTREL.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12801884 2003 CRHSP-24 phosphorylation is regulated by multiple signaling pathways in pancreatic acinar cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11842224 2002 The archetype STYX/dead-phosphatase complexes with a spermatid mRNA-binding protein and is essential for normal sperm production.
9712905 1998 Purification and characterization of a novel physiological substrate for calcineurin in mammalian cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.