Property Summary

NCBI Gene PubMed Count 53
PubMed Score 89.94
PubTator Score 53.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.600 1.9e-07
osteosarcoma -1.735 1.0e-04
tuberculosis 2.100 3.1e-07

Protein-protein Interaction (8)

Gene RIF (37)

PMID Text
26722558 We observed no significant association between the investigated CARD9 SNPs and the susceptibility of either Crohn's disease or ulcerative colitis
26679537 our data highlight the critical role of CARD9-dependent neutrophil trafficking into the central nervous system
26521038 Impaired RASGRF1/ERK-mediated GM-CSF response characterizes CARD9 deficiency in French-Canadians.
26498133 This study identified two novel independent loci (MAP3K14 and CARD9) strongly associated with joint damage in Mexican Americans and European Americans and a few shared loci showing suggestive evidence for association.
26488816 A CARD9 variant (protective against inflammatory bowel disease)is C-terminally truncated and acts in a dominant-negative manner for CARD9-mediated cytokine production. K125 is the CARD9 ubiquitinated residue. Ubiquitination is needed for CARD9 activity.
26202982 Data indicate that MINCLE receptor is able to mediate the response to trehalose-6,6-dimycolate (TDM) dependent on SYK kinase and CARD9 protein.
26044242 homozygous mutation results in deep dermatophytosis due to impaired neutrophil fungal killing
25790941 These results indicate that CARD9 is indispensable for Phialophora verrucosa killing by polymorphonuclear neutrophils.
25702837 Invasive infections of the CNS or digestive tract caused by Candida species in previously healthy children and adults might be caused by inherited CARD9 deficiency.
25621893 MyD88 and CARD9 act in two discrete phases and in two cellular compartments to direct chemokine- and neutrophil-dependent host defense.
25305756 A new genome-wide significant association between CARD9 and IgA nephropathy.
25267792 CARD9 regulates H-Ras activation by linking Ras-GRF1 to H-Ras, which mediates Dectin-1-induced extracellular signal-regulated protein kinase (ERK) activation and proinflammatory responses when stimulated by their ligands.
25057046 These are the first 2 patients with inherited CARD9 deficiency.
24777530 this study reports a direct cytosolic interaction between the DNA-damage sensor Rad50 and the innate immune system adaptor CARD9.
24722209 Results indicating that CARD9 is a regulator of metastasis-associated macrophages will lead to new insights into evolution of the microenvironments supporting tumor metastasis.
24704721 In a patient with CARD9 deficiency, clinical remission with adjunctive GM-CSF therapy suggested that a CARD9/GM-CSF axis contributes to susceptibility to candidiasis.
24686315 There is emergening evidence that genetic component is inviolved in the development of onychomycosis.(review)
24465786 Intestinal failure patients with CARD9 polymorphism are less likely to develop progressive liver disease.
24334645 Our study confirmed that an SNP rs11145835 in 9q34.3 that harbors CARD9 and SNAPC4 is associated with ankylosing spondylitis in a Chinese Han population
24231284 CARD9 mutations linked to subcutaneous phaeohyphomycosis and TH17 cell deficiencies.
24131138 All the patients with deep dermatophytosis had autosomal recessive CARD9 deficiency.
24068945 Our results confirmed significant association to rare non-synonymous coding variants in both IL23R and CARD9, previously identified from sequencing of CD loci, as well as identified a novel association in RNF186
24018495 CARD9 may be involved in hepatic carcinogenesis associated with hepatitis C in Egyptian patients.
22423967 Rubicon as a specific feedback inhibitor of CARD9-mediated pattern recognition receptor-signal transduction, preventing unbalanced proinflammatory responses.
22013052 Human coronavirus-induced neuronal programmed cell death required cyclophilin d but not caspase 3 caspase 9 activities.
21985303 variation in CARD9 genes was not associated with susceptibility to opportunistic fungal or bacterial infections in HIV-positive patients.
21881131 genetic variation in CARD9 was not associated with susceptibility to candidemia.
21436691 High caspase-9 activity is associated with cervical malignancy.
21425313 Three ulcerative colitis susceptibility loci are associated with primary sclerosing cholangitis and indicate a role for IL2, REL, and CARD9.
20463747 The single nucleotide polymorphisms most strongly associated with ankylosing spondylitis are those most associated with CARD9 expression.
20463747 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19864672 An autosomal recessive form of susceptibility to chronic mucocutaneous candidiasis is associated with homozygous mutations in CARD9.
19809088 Studies suggest that the apoptosome contains a 1:1 Apaf-1:caspase-9 stoichiometry.
18439550 CARD9 and IL18RAP are IBD loci important in innate immunity in the predisposition to both CD and UC.
18439550 Observational study of gene-disease association. (HuGE Navigator)
17936701 Data show that pVHL acts as an adaptor to promote the inhibitory phosphorylation of the NF-kappaB agonist Card9 by casein kinase 2.

AA Sequence

MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQR      1 - 70
TGHKGYVAFLESLELYYPQLYKKVTGKEPARVFSMIIDASGESGLTQLLMTEVMKLQKKVQDLTALLSSK     71 - 140
DDFIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEI    141 - 210
DQLKHSLMKAEDDCKVERKHTLKLRHAMEQRPSQELLWELQQEKALLQARVQELEASVQEGKLDRSSPYI    211 - 280
QVLEEDWRQALRDHQEQANTIFSLRKDLRQGEARRLRCMEEKEMFELQCLALRKDSKMYKDRIEAILLQM    281 - 350
EEVAIERDQAIATREELHAQHARGLQEKDALRKQVRELGEKADELQLQVFQCEAQLLAVEGRLRRQQLET    351 - 420
LVLSSDLEDGSPRRSQELSLPQDLEDTQLSDKGCLAGGGSPKQPFAALHQEQVLRNPHDAGLSSGEPPEK    421 - 490
ERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS                            491 - 536
//

Text Mined References (57)

PMID Year Title
26722558 2015 Genetic association between CARD9 variants and inflammatory bowel disease was not replicated in a Chinese Han population.
26679537 2015 CARD9-Dependent Neutrophil Recruitment Protects against Fungal Invasion of the Central Nervous System.
26521038 2016 Impaired RASGRF1/ERK-mediated GM-CSF response characterizes CARD9 deficiency in French-Canadians.
26498133 2015 Genetic Variants Influencing Joint Damage in Mexican Americans and European Americans With Rheumatoid Arthritis.
26488816 2015 Ubiquitin Ligase TRIM62 Regulates CARD9-Mediated Anti-fungal Immunity and Intestinal Inflammation.
26202982 2015 Contribution of MINCLE-SYK Signaling to Activation of Primary Human APCs by Mycobacterial Cord Factor and the Novel Adjuvant TDB.
26044242 2015 A homozygous CARD9 mutation in a Brazilian patient with deep dermatophytosis.
25790941 2015 CARD9 deficiencies linked to impaired neutrophil functions against Phialophora verrucosa.
25702837 2015 Inherited CARD9 deficiency in otherwise healthy children and adults with Candida species-induced meningoencephalitis, colitis, or both.
25621893 2015 Compartment-specific and sequential role of MyD88 and CARD9 in chemokine induction and innate defense during respiratory fungal infection.
25416956 2014 A proteome-scale map of the human interactome network.
25305756 2014 Discovery of new risk loci for IgA nephropathy implicates genes involved in immunity against intestinal pathogens.
25267792 2014 CARD9 mediates Dectin-1-induced ERK activation by linking Ras-GRF1 to H-Ras for antifungal immunity.
25057046 2015 Inherited CARD9 deficiency in 2 unrelated patients with invasive Exophiala infection.
24960071 2014 Interaction between NOD2 and CARD9 involves the NOD2 NACHT and the linker region between the NOD2 CARDs and NACHT domain.
24777530 2014 Rad50-CARD9 interactions link cytosolic DNA sensing to IL-1? production.
24722209 2014 Tumor cell-activated CARD9 signaling contributes to metastasis-associated macrophage polarization.
24704721 2014 CARD9 deficiency and spontaneous central nervous system candidiasis: complete clinical remission with GM-CSF therapy.
24686315 2014 Do genetic mutations and genotypes contribute to onychomycosis?
24465786 2014 A CARD9 polymorphism is associated with decreased likelihood of persistent conjugated hyperbilirubinemia in intestinal failure.
24334645 2014 Evidence for genetic association of CARD9 and SNAPC4 with ankylosing spondylitis in a Chinese Han population.
24231284 2014 CARD9 mutations linked to subcutaneous phaeohyphomycosis and TH17 cell deficiencies.
24131138 2013 Deep dermatophytosis and inherited CARD9 deficiency.
24068945 2013 Deep resequencing of GWAS loci identifies rare variants in CARD9, IL23R and RNF186 that are associated with ulcerative colitis.
24018495 Caspase recruitment domains. New potential markers for diagnosis of hepatocellular carcinoma associated with HCV in Egyptian patients.
23335372 2013 Invasive fungal infection and impaired neutrophil killing in human CARD9 deficiency.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23017229 2012 Genome-wide association replicates the association of Duffy antigen receptor for chemokines (DARC) polymorphisms with serum monocyte chemoattractant protein-1 (MCP-1) levels in Hispanic children.
22936669 2013 A genome-wide association study on a southern European population identifies a new Crohn's disease susceptibility locus at RBX1-EP300.
22423967 2012 The autophagy regulator Rubicon is a feedback inhibitor of CARD9-mediated host innate immunity.
22267217 2012 Dectin-1 is an extracellular pathogen sensor for the induction and processing of IL-1? via a noncanonical caspase-8 inflammasome.
22013052 2012 Human coronavirus-induced neuronal programmed cell death is cyclophilin d dependent and potentially caspase dispensable.
21985303 2011 Variation in genes of ?-glucan recognition pathway and susceptibility to opportunistic infections in HIV-positive patients.
21881131 2011 Genetic variation in the dectin-1/CARD9 recognition pathway and susceptibility to candidemia.
21743469 2011 Interaction between ERAP1 and HLA-B27 in ankylosing spondylitis implicates peptide handling in the mechanism for HLA-B27 in disease susceptibility.
21436691 2011 Changes in activities of caspase-8 and caspase-9 in human cervical malignancy.
21425313 2011 Three ulcerative colitis susceptibility loci are associated with primary sclerosing cholangitis and indicate a role for IL2, REL, and CARD9.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20463747 2010 Elucidating the chromosome 9 association with AS; CARD9 is a candidate gene.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
19915572 2009 Genome-wide association study of ulcerative colitis identifies three new susceptibility loci, including the HNF4A region.
19864672 2009 A homozygous CARD9 mutation in a family with susceptibility to fungal infections.
19809088 2009 Apoptosis: calling time on apoptosome activity.
18439550 2008 Genetic analysis of innate immunity in Crohn's disease and ulcerative colitis identifies two susceptibility loci harboring CARD9 and IL18RAP.
18088087 2008 Phosphoproteome of resting human platelets.
17936701 2007 pVHL acts as an adaptor to promote the inhibitory phosphorylation of the NF-kappaB agonist Card9 by CK2.
17187069 2007 The adaptor protein CARD9 is required for innate immune responses to intracellular pathogens.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11259443 2001 Card10 is a novel caspase recruitment domain/membrane-associated guanylate kinase family member that interacts with BCL10 and activates NF-kappa B.
11053425 2000 CARD9 is a novel caspase recruitment domain-containing protein that interacts with BCL10/CLAP and activates NF-kappa B.