Property Summary

NCBI Gene PubMed Count 12
PubMed Score 388.95
PubTator Score 2.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.440 2.3e-03
adult high grade glioma 2.500 2.4e-05
glioblastoma 1.200 1.9e-02
group 3 medulloblastoma -1.700 2.4e-03
invasive ductal carcinoma 1.071 1.5e-02
lung carcinoma -2.000 1.0e-27
non-small cell lung cancer -1.918 9.5e-21
ovarian cancer 1.100 1.8e-02
subependymal giant cell astrocytoma 2.925 8.1e-03
tuberculosis 2.000 1.8e-07
ulcerative colitis 1.700 2.4e-08

Gene RIF (6)

AA Sequence

MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQ      1 - 70
ICITYICEEDSYLAETLGLSAALQAVQDNPAMPTCSSPEGRIKLCFLEDAQRIWKQKLQRCHVQNTIIKW     71 - 140
SERYTSGSFEMQWLFLRTNFIERFWRNILLLPLHKGSLYPRIPGLGKELQTGTHKLS                 141 - 197
//

Text Mined References (14)

PMID Year Title