Property Summary

NCBI Gene PubMed Count 78
PubMed Score 129.23
PubTator Score 98.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 2.5e-02

Synonym

Accession Q9BXL7 A4D1Z7 Q2NKN7 Q548H3
Symbols PPBL
BENTA
BIMP3
IMD11
CARMA1

Gene

PDB

4JUP   4LWD  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (56)

PMID Text
26884335 Cooperative Control of Caspase Recruitment Domain-containing Protein 11 (CARD11) Signaling by an Unusual Array of Redundant Repressive Elements.
26884334 single amino acid oncogenic CARD11 mutations can perturb or bypass the action of redundant inhibitory REs to achieve the level of hyperactive CARD11 signaling required to support lymphoma growth.
26747248 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26668357 Data show that caspase recruitment domain-containing protein 11/B-cell CLL/lymphoma 10/mucosa-associated lymphoid tissue lymphoma translocation gene 1 signaling drives lymphoproliferation through NF-kappa B and c-Jun N-terminal kinase activation.
26289640 Both carried homozygous germline mutations in CARD11 (p.Cys150*), impairing NF-kappaB signaling and IL-2 production
26212909 CARD11-mediated alterations in NF-kappaB signaling may be an early event in the development of cutaneous squamous cell carcinoma
26206083 Taken together, our data indicate that miR-539 is a novel regulator of migration and invasion in human thyroid cancer cells by targeting CARMA1.
25930198 Three patients have been described with mild B-cell lymphocytosis and a CARD11 C49Y missense mutation.
25602919 CARMA1 clustering through SH3-GUK domain interactions is required for its activation of NF-kappaB signalling
25384343 Overexpression of CARMA-BCL10-MALT in T-ALL may contribute to the constitutive cleavage and inactivation of A20, which enhances NF-kappaB signaling and may be related to T-ALL pathogenesis.
25320244 Data indicate that caspase recruitment domain family, member 11 protein CARD11 has complex 5'UTRs and is sensitive to eIF4A RNA helicase inhibition.
25001930 Data indicate that caspase recruitment domain membrane-associated guanylate kinase protein 1 (CARMA1)-silenced cells K562/shCARMA 1-93 showed the greatest inhibition of CARMA 1 gene and protein expressions.
24548923 Data indicate that phosphorylation of Carma1 down-stream of TCR/CD28-dependent NF-kappaB induction is regulated in part by Akt.
24465689 CKIP-1 interacts with CARMA1 and has an inhibitory effect on PKCtheta;-CBM-NF-kappaB signaling.
24074955 Combining crystallography, nuclear magnetic resonance, and electron microscopy, we reveal the structure of the Bcl10 CARD filament and the mode of interaction between CARMA1 and Bcl10
23632891 SMO activates trimeric G proteins and CARMA1-associated signaling complex, leading to NF-kappaB activation and results in diffuse large B-cell lymphoma.
23545653 CARMA1 CARD was then purified to homogeneity and crystallized at 293 K. Finally, X-ray diffraction data were collected to a resolution of 3.2 A from a crystal belonging to space group P2(1)2(1)2(1)
23374270 In patients with CARD11 deficiency, the combination of impaired activation and especially upregulation of inducible T-cell costimulator on T cells.
23322406 These data provide the first evidence that ubiquitination of CARMA1 by STUB1 promotes TCR-induced NF-kappaB signaling.
23149938 CARD11 gain-of-function mutations selectively confer the ability to associate with Bcl10 and induce K63-linked ubiquitination of Bcl10.
23129749 CARD11 mutations may predispose to B but not T lymphoid malignancy.
23027925 Findings show that regulation of CARD11 signaling is a critical switch governing the decision between death and proliferation in antigen-stimulated mature B cells.
22808296 The present study failed to find any mut-ation in MYD88, CARD11 or CD79B in ocular MALT lymphoma.
22528498 PKCdelta is a negative regulator in T cell activation through inhibiting the assembly of CARMA1 signalosome.
22411628 distinct CARMA1-dependent control of key cell cycle proteins in T cells is coordinated by ADAP
22397314 The incidence of CARD11 mutations was 10.7% in Middle Eastern diffuse large B-cell lymphoma.
22371397 In Jurkat cells, CARMA1 is required for induction of Th2 transcription factors, GATA3 and JunB, and controls IL-4, IL-5, and IL-10 production.
22303480 TLR-dependent TRAF6-MKK3-p38 MAPK signaling pathway synergizes with PKCtheta;-MEK-ERK signaling pathway. CARMA1 plays a crucial role in mediating this synergistic effect via TRAF6.
22075698 A combination of in vitro and in vivo studies demonstrates that the CARMA1 transgene is required for optimal T cell responses to T cell receptor engagement and development of allergic airway inflammation, after activation of T cells in a murine model.
21905497 genetic polymorphism is associated with common variable immunodeficiency
21569705 expression of CARMA1 mRNA is likely associated with the expression of MUM1 and shows male predominance in diffuse large B cell lymphoma.
21266526 A20, ABIN-1/2, and CARD11 mutations have prognostic value in gastrointestinal diffuse large B-cell lymphoma
21176849 Very low mutation frequency of exons 5-9 in the CARD11 gene from 186 adult acute leukemia and 31 multiple myeloma samples.
21172665 CARM1 is transcriptional coactivators that deposit H3R17me2a and H4R3me2a marks, respectively.
21157432 PP2A-mediated dephosphorylation of Carma1 is a critical step to limit T-cell activation and effector cytokine production.
20799731 results establish a mechanism that explains how diffuse large B cell lymphoma-associated mutations in CARD11 can initiate spontaneous, receptor-independent activation of NF-kappaB
20544211 The mutations of the oncogene CARD11 may contribute to NF-kappaB activation and thereby play a role in the pathogenesis of Primary CNS lymphoma.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20164171 the ADAP CARMA1 binding site is required for IKK gamma ubiquitination; both TAK1 and CARMA1 binding sites are required for IkappaB alpha phosphorylation and degradation and NF-kappaB nuclear translocation
19706536 Results suggest HPK1-mediated phosphorylation of CARMA1 as an additional regulatory mechanism tuning the NF-kappaB response upon TCR stimulation.
19444310 T-cell activation triggers the recruitment of the COP9 signalosome (CSN) to the Carma1-Bcl10-Malt1 (CBM) complex, and CSN downregulation impairs TCR-induced IKK activation.
19104039 NF-kappaB pathway activation by CARD11 or tumor necrosis factor-alpha, compensatory IKKalpha activity was also observed with IKKbeta
18625728 Data show that the protein kinase C-responsive inhibitory domain of CARD11 functions in NF-kappaB activation to regulate the association of multiple signaling cofactors that differentially depend on Bcl10 and MALT1 for association.
18323416 results demonstrate that CARD11 is a bona fide oncogene in diffuse large B cell lymphoma
18231929 H-RS cells show a deregulated B cell programme 8 lacking expression of the lymphocyte specific CARMA1 protein.
17428801 oligomerization of CARMA1 is through its Coiled-coil domain. Disruption of the predicted structure of the Coiled-coil domain of CARMA1 impaired its oligomerization and, importantly, abrogated CARMA1-mediated NF-kappaB activation
17287217 CD26 interacts with CARMA1 in T-cells, resulting in signaling events that lead to activation.
16809782 CaMKII phosphorylates CARMA1 on Ser109 and that the phosphorylation facilitates the interaction between CARMA1 and Bcl10.
16520020 These findings suggest that endogenous Nore1B recruits active Ras to the APC-T cell interface and mediates the interaction between Ras and Carma1.
16508008 CARMA1 complex is required for induction of NF-kappaB by Akt
16356856 Phosphorylation of CARMA1 plays a critical role in T Cell receptor-mediated NF-kappaB activation.
15184390 CARMA1 and CARMA3 bind to Ikappa kinase gamma-NFkappaB in B and T lymphocytes
14739370 Observational study of gene-disease association. (HuGE Navigator)
12356734 CARD11 mediates factor-specific activation of NF-kappaB by the T cell receptor complex
12154360 CARMA1 is a critical lipid raft-associated regulator of TCR-induced NF-kappa B activation and CD28 costimulation-dependent Jnk activation.
12154356 CARMA1 is an essential signaling component that mediates TCR-induced NF-kappa B activation.

AA Sequence

MPGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLNAPMLPSKI      1 - 70
NRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVVEEGHEGLTHFLMNEVIKLQQ     71 - 140
QMKAKDLQRCELLARLRQLEDEKKQMTLTRVELLTFQERYYKMKEERDSYNDELVKVKDDNYNLAMRYAQ    141 - 210
LSEEKNMAVMRSRDLQLEIDQLKHRLNKMEEECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKN    211 - 280
QELQSIIQAGKRSLPDSDKAILDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKYLEEKEDLELK    281 - 350
CSTLGKDCEMYKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIE    351 - 420
MVRREACIVNLESKLRRLSKDSNNLDQSLPRNLPVTIISQDFGDASPRTNGQEADDSSTSEESPEDSKYF    421 - 490
LPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQAKGHEEEGTDASPSSCGSLPITNSFTKMQPPRSRSSI    491 - 560
MSITAEPPGNDSIVRRYKEDAPHRSTVEEDNDSGGFDALDLDDDSHERYSFGPSSIHSSSSSHQSEGLDA    561 - 630
YDLEQVNLMFRKFSLERPFRPSVTSVGHVRGPGPSVQHTTLNGDSLTSQLTLLGGNARGSFVHSVKPGSL    631 - 700
AEKAGLREGHQLLLLEGCIRGERQSVPLDTCTKEEAHWTIQRCSGPVTLHYKVNHEGYRKLVKDMEDGLI    701 - 770
TSGDSFYIRLNLNISSQLDACTMSLKCDDVVHVRDTMYQDRHEWLCARVDPFTDHDLDMGTIPSYSRAQQ    771 - 840
LLLVKLQRLMHRGSREEVDGTHHTLRALRNTLQPEEALSTSDPRVSPRLSRASFLFGQLLQFVSRSENKY    841 - 910
KRMNSNERVRIISGSPLGSLARSSLDATKLLTEKQEELDPESELGKNLSLIPYSLVRAFYCERRRPVLFT    911 - 980
PTVLAKTLVQRLLNSGGAMEFTICKSDIVTRDEFLRRQKTETIIYSREKNPNAFECIAPANIEAVAAKNK    981 - 1050
HCLLEAGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATV   1051 - 1120
EPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL                                       1121 - 1154
//

Text Mined References (83)

PMID Year Title
26884335 2016 Cooperative Control of Caspase Recruitment Domain-containing Protein 11 (CARD11) Signaling by an Unusual Array of Redundant Repressive Elements.
26884334 2016 Intramolecular Interactions and Regulation of Cofactor Binding by the Four Repressive Elements in the Caspase Recruitment Domain-containing Protein 11 (CARD11) Inhibitory Domain.
26747248 2016 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26668357 2015 Lymphomagenic CARD11/BCL10/MALT1 signaling drives malignant B-cell proliferation via cooperative NF-?B and JNK activation.
26289640 2015 Omenn syndrome associated with a functional reversion due to a somatic second-site mutation in CARD11 deficiency.
26212909 2015 Novel CARD11 Mutations in Human Cutaneous Squamous Cell Carcinoma Lead to Aberrant NF-?B Regulation.
26206083 2015 MiR-539 inhibits thyroid cancer cell migration and invasion by directly targeting CARMA1.
25930198 2015 Mild B-cell lymphocytosis in patients with a CARD11 C49Y mutation.
25602919 2015 Clustering of CARMA1 through SH3-GUK domain interactions is required for its activation of NF-?B signalling.
25384343 2014 Characteristics of CARMA1-BCL10-MALT1-A20-NF-?B expression in T cell-acute lymphocytic leukemia.
25320244 2014 Inhibiting CARD11 translation during BCR activation by targeting the eIF4A RNA helicase.
25001930 2014 [Knock-down of CARMA1 in K562 cells inhibits the invasion and metastasis of K562 cells].
24548923 2014 Phosphorylation of Carma1, but not Bcl10, by Akt regulates TCR/CD28-mediated NF-?B induction and cytokine production.
24465689 2014 CKIP-1 is an intrinsic negative regulator of T-cell activation through an interaction with CARMA1.
24074955 2013 Structural architecture of the CARMA1/Bcl10/MALT1 signalosome: nucleation-induced filamentous assembly.
23632891 2013 Trimeric G protein-CARMA1 axis links smoothened, the hedgehog receptor transducer, to NF-?B activation in diffuse large B-cell lymphoma.
23545653 2013 Crystallization and preliminary X-ray crystallographic studies of the CARD domain of human CARMA1.
23374270 2013 Deficiency of caspase recruitment domain family, member 11 (CARD11), causes profound combined immunodeficiency in human subjects.
23322406 2013 STUB1 is essential for T-cell activation by ubiquitinating CARMA1.
23218918 2013 White matter integrity as an intermediate phenotype: exploratory genome-wide association analysis in individuals at high risk of bipolar disorder.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23149938 2013 A quantitative signaling screen identifies CARD11 mutations in the CARD and LATCH domains that induce Bcl10 ubiquitination and human lymphoma cell survival.
23129749 2012 Congenital B cell lymphocytosis explained by novel germline CARD11 mutations.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
23027925 2012 Human lymphoma mutations reveal CARD11 as the switch between self-antigen-induced B cell death or proliferation and autoantibody production.
22808296 2012 Mutation analysis of NF-?B signal pathway-related genes in ocular MALT lymphoma.
22528498 2012 Protein kinase C-? negatively regulates T cell receptor-induced NF-?B activation by inhibiting the assembly of CARMA1 signalosome.
22411628 2012 ADAP regulates cell cycle progression of T cells via control of cyclin E and Cdk2 expression through two distinct CARMA1-dependent signaling pathways.
22397314 2012 Role of nuclear factor-?B regulators TNFAIP3 and CARD11 in Middle Eastern diffuse large B-cell lymphoma.
22371397 2012 CARMA1 controls Th2 cell-specific cytokine expression through regulating JunB and GATA3 transcription factors.
22303480 2012 PKC? synergizes with TLR-dependent TRAF6 signaling pathway to upregulate MUC5AC mucin via CARMA1.
22075698 2011 CARMA1 is necessary for optimal T cell responses in a murine model of allergic asthma.
21905497 2011 Evaluation of CARMA1/CARD11 and Bob1 as candidate genes in common variable immunodeficiency.
21569705 2011 [Correlation between the expressions of CARMA1 gene and MUM1 and its significance in diffuse large B cell lymphoma].
21269460 2011 Initial characterization of the human central proteome.
21266526 2011 A20, ABIN-1/2, and CARD11 mutations and their prognostic value in gastrointestinal diffuse large B-cell lymphoma.
21176849 2011 Very low mutation frequency of exons 5-9 in the CARD11 gene from 186 adult acute leukemia and 31 multiple myeloma samples.
21172665 2010 TDRD3 is an effector molecule for arginine-methylated histone marks.
21157432 2011 Dephosphorylation of Carma1 by PP2A negatively regulates T-cell activation.
20799731 2010 Oncogenic CARD11 mutations induce hyperactive signaling by disrupting autoinhibition by the PKC-responsive inhibitory domain.
20544211 2010 Mutations of CARD11 but not TNFAIP3 may activate the NF-kappaB pathway in primary CNS lymphoma.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20164171 2010 NF-kappaB activation in T cells requires discrete control of IkappaB kinase alpha/beta (IKKalpha/beta) phosphorylation and IKKgamma ubiquitination by the ADAP adapter protein.
19706536 2009 Phosphorylation of CARMA1 by HPK1 is critical for NF-kappaB activation in T cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19444310 2009 COP9 signalosome controls the Carma1-Bcl10-Malt1 complex upon T-cell stimulation.
19104039 2008 Compensatory IKKalpha activation of classical NF-kappaB signaling during IKKbeta inhibition identified by an RNA interference sensitization screen.
18625728 2008 The protein kinase C-responsive inhibitory domain of CARD11 functions in NF-kappaB activation to regulate the association of multiple signaling cofactors that differentially depend on Bcl10 and MALT1 for association.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18323416 2008 Oncogenic CARD11 mutations in human diffuse large B cell lymphoma.
18231929 2008 Analysis of CARMA1/BCL10/MALT1 expression in Reed-Sternberg cells of classical Hodgkin lymphoma.
17948050 2007 Malt1 ubiquitination triggers NF-kappaB signaling upon T-cell activation.
17468049 2007 Post-translational modifications regulate distinct functions of CARMA1 and BCL10.
17428801 2007 CARMA1 coiled-coil domain is involved in the oligomerization and subcellular localization of CARMA1 and is required for T cell receptor-induced NF-kappaB activation.
17287217 2007 Caveolin-1 triggers T-cell activation via CD26 in association with CARMA1.
17047224 2006 Regulation and function of IKK and IKK-related kinases.
16809782 2006 Ca2+/calmodulin-dependent protein kinase II is a modulator of CARMA1-mediated NF-kappaB activation.
16520020 2006 Nore1B regulates TCR signaling via Ras and Carma1.
16508008 2006 CARMA1 is required for Akt-mediated NF-kappaB activation in T cells.
16356856 2005 Phosphorylation of CARMA1 plays a critical role in T Cell receptor-mediated NF-kappaB activation.
16356855 2005 Phosphorylation of the CARMA1 linker controls NF-kappaB activation.
16301747 2005 PKC beta regulates BCR-mediated IKK activation by facilitating the interaction between TAK1 and CARMA1.
15802604 2005 PDK1 nucleates T cell receptor-induced signaling complex for NF-kappaB activation.
15541657 2004 The roles of CARMA1, Bcl10, and MALT1 in antigen receptor signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15184390 2004 Physical and functional interaction of CARMA1 and CARMA3 with Ikappa kinase gamma-NFkappaB essential modulator.
15125833 2004 The TRAF6 ubiquitin ligase and TAK1 kinase mediate IKK activation by BCL10 and MALT1 in T lymphocytes.
15122200 2004 CARMA1, BCL-10 and MALT1 in lymphocyte development and activation.
14739370 2004 Mutations of genes involved in the innate immune system as predictors of sepsis in very low birth weight infants.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14673152 2004 CD3/CD28 costimulation-induced NF-kappaB activation is mediated by recruitment of protein kinase C-theta, Bcl10, and IkappaB kinase beta to the immunological synapse through CARMA1.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356734 2002 CARD11 mediates factor-specific activation of NF-kappaB by the T cell receptor complex.
12154360 2002 CARMA1 is a critical lipid raft-associated regulator of TCR-induced NF-kappa B activation.
12154356 2002 A requirement for CARMA1 in TCR-induced NF-kappa B activation.
11356195 2001 Carma1, a CARD-containing binding partner of Bcl10, induces Bcl10 phosphorylation and NF-kappaB activation.
11278692 2001 CARD11 and CARD14 are novel caspase recruitment domain (CARD)/membrane-associated guanylate kinase (MAGUK) family members that interact with BCL10 and activate NF-kappa B.
11259443 2001 Card10 is a novel caspase recruitment domain/membrane-associated guanylate kinase family member that interacts with BCL10 and activates NF-kappa B.
9847074 1998 Toward a complete human genome sequence.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.