Property Summary

NCBI Gene PubMed Count 18
PubMed Score 16.61
PubTator Score 89.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
posterior fossa group B ependymoma 5.900 1.5e-24
osteosarcoma -1.110 2.8e-02
interstitial cystitis -2.900 6.2e-05
aldosterone-producing adenoma 1.337 2.4e-02
nasopharyngeal carcinoma -2.400 5.1e-08
Endometriosis -1.383 1.1e-02
breast carcinoma 1.200 8.4e-23
spina bifida -1.036 3.6e-02
Pick disease 1.500 4.3e-02
Breast cancer 1.100 6.4e-05
invasive ductal carcinoma 1.800 6.6e-03
ovarian cancer 1.300 5.4e-03
chronic rhinosinusitis -1.008 4.1e-02

Gene RIF (4)

PMID Text
20468064 Observational study of gene-disease association. (HuGE Navigator)
19275752 The calcyphosine crystal diffracted to 2.8 A and belonged to space group P2(1)2(1)2, with the unit cell parameters a=70.39 A, b=132.02 A, c=46.20 A.
18775726 These results describe the crystal structure of Ca(2+)-loaded calcyphosine up to 2.65 A resolution and reveal a protein containing two pairs of Ca(2+)-binding EF-hand motifs.
18729184 Results demonstrated the ubiquitous overexpressions of E-FABP and CAPS in EC and the correlations to the clinicopathologic parameters. CAPS might be a potential prognostic factor for survival in patients with EC

AA Sequence

MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWD      1 - 70
RNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEV     71 - 140
LRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL                         141 - 189
//

Text Mined References (18)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19275752 2009 Crystallization and preliminary crystallographic analysis of recombinant human calcyphosine.
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
18775726 2008 Crystal-structure and biochemical characterization of recombinant human calcyphosine delineates a novel EF-hand-containing protein family.
18729184 2008 Prognostic evaluation of epidermal fatty acid-binding protein and calcyphosine, two proteins implicated in endometrial cancer using a proteomic approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16823975 2006 Identification of brain cell death associated proteins in human post-mortem cerebrospinal fluid.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9224948 1997 Cloning and sequence analysis of human calcyphosine complementary DNA.
9125191 1997 Loss of calcyphosine gene expression in mouse and other rodents.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2265558 1990 Localization of human calcyphosine gene (CAPS) to the p13.3 region of chromosome 19 by in situ hybridization.