Property Summary

NCBI Gene PubMed Count 25
PubMed Score 23.48
PubTator Score 21.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
acute quadriplegic myopathy 1.166 2.7e-05
adult high grade glioma -1.100 6.4e-03
astrocytoma 1.100 1.5e-02
atypical teratoid / rhabdoid tumor 1.400 1.7e-04
Breast cancer 4.100 2.7e-02
breast carcinoma 1.400 1.4e-02
dermatomyositis -1.100 3.4e-04
ependymoma 1.400 6.2e-03
Gaucher disease type 1 -1.100 6.3e-03
glioblastoma 1.300 2.1e-02
group 3 medulloblastoma 1.300 6.5e-03
intraductal papillary-mucinous neoplasm ... 1.600 3.6e-03
lung adenocarcinoma 1.402 1.5e-09
lung cancer 1.100 1.1e-02
medulloblastoma, large-cell 2.300 1.3e-05
Multiple myeloma 2.241 3.3e-05
nasopharyngeal carcinoma 1.100 7.3e-04
oligodendroglioma 1.300 4.9e-03
osteosarcoma 2.479 2.9e-08
ovarian cancer -1.800 1.2e-05
Pick disease -1.100 6.6e-03
pituitary cancer 1.400 6.9e-06
primitive neuroectodermal tumor 1.100 3.4e-05
psoriasis 1.100 1.4e-03
Waldenstrons macroglobulinemia 1.633 2.3e-03

 GO Function (1)

Gene RIF (16)

AA Sequence

MPSATSHSGSGSKSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAMKQILGVIDKKLRNLEK      1 - 70
KKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREE     71 - 140
AEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHA    141 - 210
SIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHNHQNGLCEEEEAASAPAVEDQVPEAEPEPA    211 - 280
EEYTEQSEVESTEYVNRQFMAETQFTSGEKEQVDEWTVETVEVVNSLQQQPQAASPSVPEPHSLTPVAQA    281 - 350
DPLVRRQRVQDLMAQMQGPYNFIQDSMLDFENQTLDPAIVSAQPMNPTQNMDMPQLVCPPVHSESRLAQP    351 - 420
NQVPVQPEATQVPLVSSTSEGYTASQPLYQPSHATEQRPQKEPIDQIQATISLNTDQTTASSSLPAASQP    421 - 490
QVFQAGTSKPLHSSGINVNAAPFQSMQTVFNMNAPVPPVNEPETLKQQNQYQASYNQSFSSQPHQVEQTE    491 - 560
LQQEQLQTVVGTYHGSPDQSHQVTGNHQQPPQQNTGFPRSNQPYYNSRGVSRGGSRGARGLMNGYRGPAN    561 - 630
GFRGGYDGYRPSFSNTPNSGYTQSQFSAPRDYSGYQRDGYQQNFKRGSGQSGPRGAPRGRGGPPRPNRGM    631 - 700
PQMNTQQVN                                                                 701 - 709
//

Text Mined References (37)

PMID Year Title