1. Home
  2. Targets
  3. transporter
  4. Caprin-1

Tbio Caprin-1

May regulate the transport and translation of mRNAs of proteins involved in synaptic plasticity in neurons and cell proliferation and migration in multiple cell types.

 Comments

Property Summary

NCBI Gene PubMed Count 23
PubMed Score 19.71
PubTator Score 21.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count Z-score Confidence
Smallpox 20 3.577 1.8

Expression

  Differential Expression (25)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.633 2.3e-03
Multiple myeloma 2.241 3.3e-05
ependymoma 1.700 1.3e-02
oligodendroglioma 1.500 9.7e-03
psoriasis 1.100 1.4e-03
osteosarcoma 2.479 2.9e-08
group 4 medulloblastoma 1.800 1.2e-04
astrocytoma 1.100 1.5e-02
glioblastoma 1.400 5.9e-03
atypical teratoid / rhabdoid tumor -1.600 8.4e-05
medulloblastoma, large-cell 2.300 1.3e-05
primitive neuroectodermal tumor 1.100 3.4e-05
acute quadriplegic myopathy 1.332 3.4e-06
intraductal papillary-mucinous neoplasm ... 1.600 3.6e-03
lung cancer 1.400 1.9e-02
breast carcinoma 1.400 1.4e-02
Breast cancer 4.100 2.7e-02
pediatric high grade glioma 1.100 9.2e-03
nasopharyngeal carcinoma 1.100 7.3e-04
lung adenocarcinoma 1.402 1.5e-09
Pick disease -1.100 6.6e-03
ovarian cancer -1.800 1.2e-05
Gaucher disease type 1 -1.100 6.3e-03
pituitary cancer 1.400 6.9e-06
dermatomyositis -1.100 3.4e-04

Synonym

Accession Q14444 A6NMY7 D3DR06 Q15074 Q6IMN4 Q6IMN7 Q9BV09
Symbols M11S1
GPIAP1
RNG105
GPIP137
GRIP137
p137GPI

Gene

CAPRIN1

PANTHER Protein Class (1)

PDB

4WBE   4WBP  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (16)

See all...

 GO Function (2)

 GO Component (7)

 GO Process (3)

 Compartment GO Term (35)

See all...

 MGI Phenotype (7)

 HCA RNA Cell Line (56)

See all...

Pathway (1)

Gene RIF (14)

PMID Text
27022092 G3BP mediates the condensation of stress granules by shifting between two different states that are controlled by the phosphorylation of S149 and by binding to Caprin1 or USP10.
25784705 The G3BP1-Caprin1-PKR complex represents a new mode of PKR activation and is important for antiviral activity of G3BP1 and PKR during infection with mengovirus.
25669982 Data show that tylophorine compounds exert anti-cancer activity predominantly by targeting and sequestering the caprin-1 protein and c-Myc mRNA associated ribonucleoprotein complex.
24992036 G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.
23528710 Cyr61/Caprin-1 co-expression was associated with worse survival.
23125841 Tandem affinity purification and mass spectrometry analysis identify cell cycle associated protein 1 (CAPRIN1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23097442 These results suggest that the Japanese encephalitis virus core protein circumvents translational shutoff by inhibiting stress granule formation through an interaction with Caprin-1 and facilitates viral propagation in vitro and in vivo.
22737234 Fragile mental retardation protein interacts with the RNA-binding protein Caprin1 in neuronal RiboNucleoProtein complexes
22174317 Tandem affinity purification and mass spectrometry analysis identify cell cycle associated protein 1 (CAPRIN1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19250063 MiR-16 negatively regulate HMGA1 and caprin-1 which are involved in cell proliferation.
17210633 Caprin-1/G3BP-1 complex is likely to regulate the transport and translation of mRNAs of proteins involved with synaptic plasticity in neurons
16177067 Suppression of expression of human Caprin-1 results in slowing of the proliferation rate, due to prolongation of the G1 phase of the cell cycle, formally demonstrating that Caprin-1 is essential for normal cellular proliferation.
15471883 involvement of cellular protein p137 in transcription of intermediate stage genes may regulate the transition between early and late phases of vaccinia virus replication
14764709 Homologous region-1 (HR-1) is a novel protein domain that has been identified near the N-terminus of human caprin-1; highly conserved in vertebrates and insects, it is also present in the human caprin-2 paralog.

AA Sequence 

MPSATSHSGSGSKSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAMKQILGVIDKKLRNLEK      1 - 70
KKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREE     71 - 140
AEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHA    141 - 210
SIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHNHQNGLCEEEEAASAPAVEDQVPEAEPEPA    211 - 280
EEYTEQSEVESTEYVNRQFMAETQFTSGEKEQVDEWTVETVEVVNSLQQQPQAASPSVPEPHSLTPVAQA    281 - 350
DPLVRRQRVQDLMAQMQGPYNFIQDSMLDFENQTLDPAIVSAQPMNPTQNMDMPQLVCPPVHSESRLAQP    351 - 420
NQVPVQPEATQVPLVSSTSEGYTASQPLYQPSHATEQRPQKEPIDQIQATISLNTDQTTASSSLPAASQP    421 - 490
QVFQAGTSKPLHSSGINVNAAPFQSMQTVFNMNAPVPPVNEPETLKQQNQYQASYNQSFSSQPHQVEQTE    491 - 560
LQQEQLQTVVGTYHGSPDQSHQVTGNHQQPPQQNTGFPRSNQPYYNSRGVSRGGSRGARGLMNGYRGPAN    561 - 630
GFRGGYDGYRPSFSNTPNSGYTQSQFSAPRDYSGYQRDGYQQNFKRGSGQSGPRGAPRGRGGPPRPNRGM    631 - 700
PQMNTQQVN                                                                 701 - 709
//

Text Mined References (34)

PMID Year Title
27022092 2016 G3BP-Caprin1-USP10 complexes mediate stress granule condensation and associate with 40S subunits.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25784705 2015 Stress granules regulate double-stranded RNA-dependent protein kinase activation through a complex containing G3BP1 and Caprin1.
25669982 2015 Targeting a ribonucleoprotein complex containing the caprin-1 protein and the c-Myc mRNA suppresses tumor growth in mice: an identification of a novel oncotarget.
24992036 2014 G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23528710 2013 Caprin-1, a novel Cyr61-interacting protein, promotes osteosarcoma tumor growth and lung metastasis in mice.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23097442 2013 Japanese encephalitis virus core protein inhibits stress granule formation through an interaction with Caprin-1 and facilitates viral propagation.
22967762 2012 Characterization of O-GlcNAc cycling and proteomic identification of differentially O-GlcNAcylated proteins during G1/S transition.
22737234 2012 Fragile X mental retardation protein interacts with the RNA-binding protein Caprin1 in neuronal RiboNucleoProtein complexes [corrected].
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20696395 2010 Conserved beta-hairpin recognition by the GYF domains of Smy2 and GIGYF2 in mRNA surveillance and vesicular transport complexes.
20516077 2010 RNA granule protein 140 (RNG140), a paralog of RNG105 localized to distinct RNA granules in neuronal dendrites in the adult vertebrate brain.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19250063 2009 Two new miR-16 targets: caprin-1 and HMGA1, proteins implicated in cell proliferation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17210633 2007 Distinct structural features of caprin-1 mediate its interaction with G3BP-1 and its induction of phosphorylation of eukaryotic translation initiation factor 2alpha, entry to cytoplasmic stress granules, and selective interaction with a subset of mRNAs.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16177067 2005 Absence of caprin-1 results in defects in cellular proliferation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471883 2004 Vaccinia virus intermediate stage transcription is complemented by Ras-GTPase-activating protein SH3 domain-binding protein (G3BP) and cytoplasmic activation/proliferation-associated protein (p137) individually or as a heterodimer.
14764709 2004 Activation/division of lymphocytes results in increased levels of cytoplasmic activation/proliferation-associated protein-1: prototype of a new family of proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11060040 2000 Human pre-mRNA cleavage factor II(m) contains homologs of yeast proteins and bridges two other cleavage factors.
8786113 1996 The gene encoding the GPI-anchored membrane protein p137GPI (M11S1) maps to human chromosome 11p13 and is highly conserved in the mouse.
7657653 1995 Identification and characterization of a novel protein (p137) which transcytoses bidirectionally in Caco-2 cells.