Property Summary

NCBI Gene PubMed Count 51
PubMed Score 735.95
PubTator Score 39.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.031 1.8e-05
primary pancreatic ductal adenocarcinoma 1.388 2.1e-03
diabetes mellitus 2.300 1.3e-03
ovarian cancer 2.200 1.3e-04
pancreatic cancer 1.300 3.1e-03
dermatomyositis -1.500 5.0e-04

 CSPA Cell Line (3)

Gene RIF (20)

PMID Text
26771715 CAPNS1 depletion is coupled to impairment of breast cancer cell growth.
25636510 High levels of Capn4 expression were associated with lymph node metastasis and large tumor size in non-small cell lung cancer patients.Capn4 promotes non-small cell lung cancer progression via upregulation of matrix metalloproteinase 2.
25304384 HBXIP was able to up-regulate Capn4 at the levels of promoter.
24962955 Capn4 can contribute to hepatocellular carcinoma growth and metastasis
24703594 Capn4 upregulated MMP2 via nuclear factor-kappaB activation, manifested by increased phosphorylation of p65, a subunit of NF-kappaB.
24628706 The overexpression of Capn4 is a novel negative prognostic marker, and Capn4 may be used as a new target in therapeutic strategies for human glioma.
24514433 Capn4 mRNA and protein are increased in human clear cell renal cell carcinoma tissues and higher Capn4 levels are associated with advanced clinical tumour stage and shorter overall survival.
24297866 This study suggests that augmented calpain activity is associated with increased incidence of thrombosis under hypoxic environments.
23349941 Capn4 overexpression was implicated in ICC metastasis/invasion, and Capn4 overexpression may be used as a molecular therapeutic target for intrahepatic cholangiocarcinoma
21268016 The expression of both CAPN 1 and CAPNS 1 is increased in transplant kidneys with acute rejection, and increased expression of CAPN 1 alone was observed in kidneys with chronic rejection.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20419804 The authors conclude that hepatitis B virus X protein upregulate Capn4 through NF-kappaB/p65 to promote migration of hepatoma cells.
20107320 CAPNS1 depletion is coupled to reduced levels of H2AX phosphorylation, not only in Ras(v12) induced BJ-ET fibroblasts, but also in a number of cellular systems upon genotoxic stress
19942621 Genetic variations in LEP, CAPNS1 and ALOX15 show significant association with IL-6 expression.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18761085 RasGAP and Capns1 interaction in oncogenic Ras cells is involved in regulating migration and cell survival.
18544539 c-Myc regulates calpain activity through calpastatin; apoptosis induced by calpain inhibition is dependent on c-Myc, and calpastatin knockdown promotes transformation in c-Myc-negative cells
18234454 results reveal that especially NRF-1, along with AP-1 and, to a minor extent, an Sp1 site, is essential for human CAPNS1 promoter activity and gene expression
15611136 Whereas alphaPIX guanine nucleotide exchange factor activity contributes to enhanced formation of cellular protrusions, the GEF-independent association with calpain 4 leads to induction of a yet unknown signaling cascade resulting in cell spreading.
12121983 calpain-mediated XIAP degradation contributes to initiation of apoptosis in normal neutrophils and dysfunction of this regulatory pathway can lead to pathological neutrophil accumulation.

AA Sequence

MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGGVISAIS      1 - 70
EAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFG     71 - 140
IDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLY    141 - 210
NMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS                211 - 268
//

Text Mined References (59)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26771715 2016 Calpain restrains the stem cells compartment in breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25636510 2015 Capn4 promotes non-small cell lung cancer progression via upregulation of matrix metalloproteinase 2.
25416956 2014 A proteome-scale map of the human interactome network.
25304384 2014 The oncoprotein HBXIP enhances migration of breast cancer cells through increasing filopodia formation involving MEKK2/ERK1/2/Capn4 signaling.
24962955 2014 Capn4 contributes to tumour growth and metastasis of hepatocellular carcinoma by activation of the FAK-Src signalling pathways.
24703594 2014 Capn4 is a marker of poor clinical outcomes and promotes nasopharyngeal carcinoma metastasis via nuclear factor-?B-induced matrix metalloproteinase 2 expression.
24628706 2014 Increased expression of Capn4 is associated with the malignancy of human glioma.
24514433 2014 Capn4 mRNA level is correlated with tumour progression and clinical outcome in clear cell renal cell carcinoma.
24297866 2014 Altered expression of platelet proteins and calpain activity mediate hypoxia-induced prothrombotic phenotype.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23349941 2013 Prognostic significance of Capn4 overexpression in intrahepatic cholangiocarcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21268016 2011 Critical role of the calpain/calpastatin balance in acute allograft rejection.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20419804 2010 Hepatitis B virus X protein upregulates expression of calpain small subunit 1 via nuclear factor-kappaB/p65 in hepatoma cells.
20107320 2010 DNA damage response links calpain to cellular senescence.
19942621 2010 An integrated expression phenotype mapping approach defines common variants in LEP, ALOX15 and CAPNS1 associated with induction of IL-6.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18761085 2008 Capns1, a new binding partner of RasGAP-SH3 domain in K-Ras(V12) oncogenic cells: modulation of cell survival and migration.
18544539 2008 Regulation of calpain activity by c-Myc through calpastatin and promotion of transformation in c-Myc-negative cells by calpastatin suppression.
18519038 2008 Calcium-induced tripartite binding of intrinsically disordered calpastatin to its cognate enzyme, calpain.
18234454 2008 NRF-1, and AP-1 regulate the promoter of the human calpain small subunit 1 (CAPNS1) gene.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17264674 2007 The calpain system as a modulator of stress/damage response.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15611136 2005 AlphaPIX associates with calpain 4, the small subunit of calpain, and has a dual role in integrin-mediated cell spreading.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559243 2003 Association of the calpain/calpastatin network with subcellular organelles.
12684003 2003 A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
12591934 2003 Subcellular localization and in vivo subunit interactions of ubiquitous mu-calpain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12358155 2002 Screening the proteins that interact with calpain in a human heart cDNA library using a yeast two-hybrid system.
12121983 2002 Calpain-mediated X-linked inhibitor of apoptosis degradation in neutrophil apoptosis and its impairment in chronic neutrophilic leukemia.
11673052 2001 The structure of calcium-free human m-calpain: implications for calcium activation and function.
11517928 2001 Structural basis for possible calcium-induced activation mechanisms of calpains.
11516996 2001 The calpain family and human disease.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10666632 2000 Crystallization and preliminary X-ray analysis of recombinant full-length human m-calpain.
10661889 2000 Calpains and muscular dystrophies.
10639123 2000 The crystal structure of calcium-free human m-calpain suggests an electrostatic switch mechanism for activation by calcium.
9326644 1997 Functional cleavage of the common cytokine receptor gamma chain (gammac) by calpain.
9110174 1997 Large-scale concatenation cDNA sequencing.
8702541 1996 The major calpain isozymes are long-lived proteins. Design of an antisense strategy for calpain depletion in cultured cells.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8561910 1995 Calpain: novel family members, activation, and physiologic function.
3024120 1986 Gene organization of the small subunit of human calcium-activated neutral protease.
3016651 1986 Nucleotide sequence of a cDNA coding for the small subunit of human calcium-dependent protease.
2209092 1990 Four genes for the calpain family locate on four distinct human chromosomes.
1656060 1991 Calcium-activated neutral proteinase (CANP; calpain) activity in Schwann cells: immunofluorescence localization and compartmentation of mu- and mCANP.