Property Summary

NCBI Gene PubMed Count 53
PubMed Score 797.83
PubTator Score 39.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.031 1.8e-05
dermatomyositis -1.500 5.0e-04
diabetes mellitus 1.500 1.0e-02
ovarian cancer 2.200 1.3e-04
pancreatic cancer 1.300 3.1e-03
primary pancreatic ductal adenocarcinoma 1.388 2.1e-03

 CSPA Cell Line (3)

Protein-protein Interaction (2)

Gene RIF (21)

AA Sequence

MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGGVISAIS      1 - 70
EAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFG     71 - 140
IDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLY    141 - 210
NMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS                211 - 268
//

Text Mined References (61)

PMID Year Title