Property Summary

NCBI Gene PubMed Count 8
PubMed Score 64.74
PubTator Score 6.20

Knowledge Summary


No data available


  Disease (2)


  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 5.9e-05
atypical teratoid / rhabdoid tumor 1.200 6.8e-04
glioblastoma 1.100 8.3e-04
medulloblastoma, large-cell 1.500 1.7e-03

AA Sequence

HRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL                                     1051 - 1086

Text Mined References (11)

PMID Year Title
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10524757 1998 Sequencing analysis of forty-eight human image cDNA clones similar to Drosophila mutant protein.
9722942 1998 SOLH, a human homologue of the Drosophila melanogaster small optic lobes gene is a member of the calpain and zinc-finger gene families and maps to human chromosome 16p13.3 near CATM (cataract with microphthalmia).
8640222 1996 Identification and mapping of human cDNAs homologous to Drosophila mutant genes through EST database searching.