Property Summary

NCBI Gene PubMed Count 146
PubMed Score 193.50
PubTator Score 267.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 6.4e-03

Gene RIF (191)

PMID Text
26376770 due to its association with androgen excess in phenotype A, CAPN 10 gene polymorphism UCSNP-43 could be used as a genetic marker for CVD in young PCOS women.
25982606 SNP-63 and indel-19 variant of the CAPN10 gene do not represent a risk factor for polycystic ovary syndrome in Mexican women of reproductive age.
25867367 Data indicate no association between calpain 10 (CAPN10) polymorphisms and type 2 diabetes mellitus.
25773692 Different mutations in CAPN10 have already been found in three independent Iranian families
25617558 SNP-19 in CAPN10 may participate in the development of diabetes mellitus type 2
25504243 Genotype I/I of SNP19 in CAPN10 was significantly associated with excess weight in Colombian patients 10-18 years of age even those with physically active lifestyles.
25382134 genetic association studies in Asian populations: Data suggest that an SNP in CAPN10 (SNP43 G>A, rs3792267) is associated with type 2 diabetes in Asian populations, especially in Chinese populations. [META-ANALYSIS]
25327507 The present study provides the first observation of an association between a variant in CAPN10 gene and the response to metformin therapy in patients with type 2 diabetes
25238846 Subjects with the GG genotype of the rs2975762 variant of the CAPN10 gene were better responders to dietary intervention, showing increased HDL-C concentrations from the first month of treatment
24993116 This work confirms the association of CAPN10 gene with metabolic components in PCOS and highlights the role of haplotypes as strong and efficient genetic markers.
24802731 121 haplotype and 122/121 haplotype combination of SNP-19, -44 and -63 in the Calpain-10 gene are associated with the development of type 2 diabetes in Turkish patients.
24779302 Calpain 10 shows association between the single nucleotide polymorphism (SNP)-43, but not SNP-19 nor -63, and type 2 diabetes mellitus in the Kurdish ethnic group of West Iran
24612564 We replicated the significant association of rs1801278 and rs3792267 SNPs of the IRS1 and CAPN10 genes with T2DM in the population of Hyderabad.
24429295 results of present meta-analysis indicate an association of T2D with carriers of DD genotype of CAPN10 I/D polymorphism
24377587 Calpain-10 SNP43 and SNP19 polymorphisms are associated with colorectal cancer.
24266779 Variations of SNP-43, -63 and Indel-19 of CAPN10 were not associated with an increased risk of developing gestational diabetes mellitus.
24034724 Used homology modelling technique to study the 3D structure of calpain-10 from Homo sapiens and its interaction with the protease inhibitor SNJ-1715.
23994294 Polymorphisms in the Calpain-10 gene may be risk factors for PCOS, especially among Asian populations.[meta-analysis]
23687414 GAEC1 regulates the expression of CAPN10 in esophageal squamous cell carcinoma. Calpain 10 expression is a potential prognostic marker.
23262350 We identified reduced Calpain-10 expression in a pediatric population with overweight and obese phenotypes.
23021796 Significant association of SNP -43 in CAPN10 with the risk of cardiovascular disease coexisting with T2 Diabetes mellitus.
22796443 analysis of copy number variation of CAPN10 in Thais with type 2 diabetes by multiplex PCR and denaturing high performance liquid chromatography
22384174 CAPN10 SNPs and haplotypes are associated with polycystic ovary syndrome among South Indian Women
21906115 Studies indicate UCSNP-63 of CAPN 10 gene was significantly associated with polycystic ovary syndrome (PCOS).
21389182 genetic association studies in a European cohort: CAPN10 SNP (rs2953171) may influence insulin sensitivity by interacting with plasma fatty acid composition in subjects with metabolic syndrome
20923526 Meta-analysis and uncategorized study of gene-disease association. (HuGE Navigator)
20881413 SNP-44 polymorphism of the calpain-10 gene has a significant association with T2DM patients in the Gaza strip
20881413 Observational study of gene-disease association. (HuGE Navigator)
20848425 Calpain 10 gene polymorphism is modifying laryngeal cancer risk and mortality in Spanish population.
20848425 Observational study of gene-disease association. (HuGE Navigator)
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20667559 This study raises the possibility that the 2111 haplotype of SNPs -44, -43, -19, and -63 may be associated with type 2 diabetes mellitus, although none of these SNPs may be individually associated with diabetes.
20667559 Observational study of gene-disease association. (HuGE Navigator)
20570542 calpain 10 UCSNP-19 polymorphism and haplotype 111 contribute to the risk of type 2 diabetes (T2DM) in Tunisian subjects but no significant association between calpain 10 diplotypes and T2DM was demonstrated
20570542 Observational study of gene-disease association. (HuGE Navigator)
20470430 CAPN10 UCSNP-19 variant, and the 111 haplotype contribute to the risk of T2D in Tunisian subjects; no significant associations between CAPN10 diplotypes and T2D were demonstrated for Tunisians.
20470430 Observational study of gene-disease association. (HuGE Navigator)
20406624 CAPN10 gene may play an important role in the pathogenesis of impaired fasting glucose or impaired glucose tolerance in patients with esential hypertension.
20406624 Observational study of gene-disease association. (HuGE Navigator)
20368234 the most common haplotype 121 (OR = 0.70 95% CI: 0.50-0.99) was associated with a reduced risk for type 2 diabetes in East Indian population
20368234 Observational study of gene-disease association. (HuGE Navigator)
20193213 The association with T2DM in different races was evaluated. SNP43-G allele, G/G genotype, 111/221 were risk factors to Mongoloid race. And SNP-C allele, 111/111 haplotype combination were risk factors to Caucasoid race, and SNP44-C allele to Hybrid race.
20193213 Observational study of gene-disease association. (HuGE Navigator)
20178008 variation in CAPN10 may be associated with increased risk of pancreatic cancer among smokers
20178008 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20142250 prostate cancer was positively associated with the CAPN10 rs3792267 G allele
20119856 Certain three window haplotypes may confer increased risk for T2DM and others may be protective suggesting that genetic variation in CAPN10 gene may be one factor involved in the aetiology of T2DM in Irish adults.
20119856 Observational study of gene-disease association. (HuGE Navigator)
20075150 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19752882 Patients' higher body mass index and SNP-63 minor T allele carrier status were identified as independent posttransplant diabetes mellitus risk factors.
19752882 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19688040 calpain-10 mRNA was elevated by 64% in pancreatic islets from patients with T2D compared with non-diabetic donors. Moreover, the calpain-10 expression correlated positively with arginine-stimulated insulin release in islets from non-diabetic donors
19688040 Observational study of gene-disease association. (HuGE Navigator)
19643578 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19570442 CAPN10 SNP-19 is associated with glucose metabolism disorders in pregnant women.
19565864 Observational study of gene-disease association. (HuGE Navigator)
19491387 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19418728 SNP43 polymorphism may influence the response to treatment with sulphonylurea and metformin, the expression being dependent on obesity.
19418728 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19387820 Observational study of gene-disease association. (HuGE Navigator)
19337008 Calpain 10 gene SNP 44 allele polymorphism may have a role in PCOS pathogenesis.
19337008 Observational study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
19297292 Polymorphism is associated with a high risk of type 2 diabetes only in one Arab sub-group of the Tunisian population.
19297292 Observational study of gene-disease association. (HuGE Navigator)
19193380 CAPN10 may have a role as a common genetic determinant of diabetes and atherosclerosis in Hispanics
19193380 Observational study of gene-disease association. (HuGE Navigator)
19144693 Calpain 10 levels decreased linearly in kidney with age in the absence of changes in calpains 1 or 2.
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18722363 Our data suggest the contribution of CAPN10 gene polymorphism to polycystic ovary syndrome in Chilean women
18722363 Observational study of gene-disease association. (HuGE Navigator)
18701098 Our data showed that 111 haplotype and 111/121 and 111/111 diplotypes in the CAPN-10 gene were associated with a significantly increased risk of PCOS
18701098 Observational study of gene-disease association. (HuGE Navigator)
18698425 CAPN10 gene is associated with insulin resistance phenotypes in the Spanish Caucasoid population.
18698425 Observational study of gene-disease association. (HuGE Navigator)
18683748 CAPN-10 gene SNP-56 plays a role in glucose and lipid metabolism in Chinese PCOS patients but does not contribute to the genetic susceptibility of PCOS.
18683748 Observational study of gene-disease association. (HuGE Navigator)
18554168 We conclude that the calpain 10 SNP-44 gene polymorphism may be accepted as a risk factor in the development of type 2 diabetes mellitus (T2DM) and elevated BMI in T2DM patients in a Turkish population.
18554168 Observational study of gene-disease association. (HuGE Navigator)
18487065 In the Tunisian population, study found genetic variants within CAPN10 that are linked with type 2 diabetes and a novel haplotype combination, 121/221, associated with an increased susceptibility.
18487065 Observational study of gene-disease association. (HuGE Navigator)
18452715 calpain-10 may require a special intracellular localization or interacting partner(s) to acquire proteolytic activity
18367022 article reviews genetic evidence for association between CAPN10 & type 2 diabetes mellitus; biologic function of calpain 10 is discussed along with results from recent genome-wide association studies that have failed to put CAPN10 among the top signals
18248681 Observational study of genotype prevalence. (HuGE Navigator)
18241614 genetic variation at the CALPN10 loci may confer higher cardiovascular disease risk in patients with type 2 diabetes mellitus
18167206 Observational study of gene-disease association. (HuGE Navigator)
18167206 CAPN10 gene variations might play roles in the risk of diabetes and hypertension in northern Han Chinese population.
17964829 human lymphocytes express calpain-10 mRNA and protein, showing a similar expression between diabetic and control subjects, nevertheless in the diabetic group calpain activity was less glucose-sensitive.
17855447 Observational study of gene-disease association. (HuGE Navigator)
17855447 we did not observe any significant associations of the common SNPs or haplotypes across the CAPN10 gene with diabetes risk in our large and ethnically diverse cohort of postmenopausal women
17601994 Observational study of gene-disease association. (HuGE Navigator)
17572128 Calpain-10 may exert a direct regulatory effect upon the glucose uptake mechanism, raather than by insulin stimulation.
17570749 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17560157 Fresh hope for the development of novel diabetic treatmentsutilizing either pharmacological activators that specifically target calpain-10, or through targeted calpain-10 gene therapy
17559371 These results indicate a recessive model for the effect of CAPN10 variant UCSNP-44 influencing the risk of colorectal cancer and suggest a novel genetic link between type 2 diabetes mellitus and colon carcinoma.
17559371 Observational study of gene-disease association. (HuGE Navigator)
17511963 a defective CAPN10 pre-mRNA processing is responsible for the decreased levels of SNP-43 A-allele transcripts in peripheral white cells of healthy and type 2 diabetes individuals
17454172 Observational study of gene-disease association. (HuGE Navigator)
17454172 CAPN10 gene UCSNP-43 polymorphisms may influence the polycystic ovary syndrome metabolic phenotype
17382509 Observational study of gene-disease association. (HuGE Navigator)
17382509 These results indicate that some CAPN10 alleles may be exerting a protective effect on laryngeal cancer risk in the Spanish population.
17106059 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17106059 the calpain-10 TGA2AGCA haplotype is associated with an increased risk for PCOS.
16873988 Calpain-10 (NIDDM1) as a Susceptibility Gene for Common Type 2 Diabetes.
16857402 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16857402 No consistent evidence of association of the CAPN10 SNP43 or SNP44 with T2D, obesity, or related quantitative traits, was found.
16837224 Meta-analysis of gene-disease association. (HuGE Navigator)
16837224 the linkage disequilibrium and haplotype diversity studies suggest a role for genetic variation in CAPN10 affecting risk of type 2 diabetes in Europeans.
16752174 Observational study of gene-disease association. (HuGE Navigator)
16752174 SNP-43 of CAPN10 may contribute to the risk of diabetes by regulating abdominal obesity in subjects with high risk of type 2 diabetes.
16721485 Observational study of gene-disease association. (HuGE Navigator)
16721485 A novel diplotype in CAPN10 gene is associated with diabetes mellitus, type 2 in the Korean population.
16546286 Observational study of gene-disease association. (HuGE Navigator)
16546286 Results suggest that a novel 111/121 haplotype combination created by the CAPN10 SNP-43, -19, and -63 increases the susceptibility to the metabolic syndrome in patients with type 2 diabetes.
16456802 Observational study of genotype prevalence. (HuGE Navigator)
16427731 Observational study of gene-disease association. (HuGE Navigator)
16377260 Observational study of gene-disease association. (HuGE Navigator)
16377260 UCSNP-19 of CAPN10 may be involved in the pathogenesis of diabetes in CF.
16333311 Observational study of gene-disease association. (HuGE Navigator)
16306378 There may be one or more relatively common alleles increasing risk of type 2 diabetes in this local region.
16186407 study provides evidence that messenger RNA expression of calpain-10 (CAPN10) in skeletal muscle is under genetic control and glucose-tolerant individuals upregulate messenger RNA levels in response to prolonged exposure to fat
16028216 Calpain 10 is a molecule of importance to insulin signaling and secretion that may have relevance to the future development of novel therapeutic targets for the treatment of T2D[review]
15926113 Observational study of gene-disease association. (HuGE Navigator)
15862281 Studies confirm calpain 10 expression in cultured muscle cells and support calpains in insulin-stimulated glucose uptake in human skeletal muscle cells that may be relevant to the pathogenesis of the peripheral insulin resistance in type 2 diabetes.
15860244 Observational study of gene-disease association. (HuGE Navigator)
15860244 Polymorphism of CAPN 10 might be associated with type 2 diabetes.
15793266 We show that the diabetes gene calpain-10 (CAPN10) plays a role in atherosclerosis, insulin sensitivity and insulin secretion in a population enriched for atherosclerosis and insulin resistance.
15696376 Observational study of gene-disease association. (HuGE Navigator)
15652721 Observational study of gene-disease association. (HuGE Navigator)
15641690 Observational study of gene-disease association. (HuGE Navigator)
15471947 an isoform of calpain-10 is a Ca2+-sensor that functions to trigger exocytosis in pancreatic beta-cells
15240652 Observational study of gene-disease association. (HuGE Navigator)
15240652 Reduced CAPN10 expression may be risk factor for features associated with metabolic syndrome in obese subjects, although variation in gene does not seem to contribute to risk for developing obesity per se.
15172858 Observational study of gene-disease association. (HuGE Navigator)
15044459 calpain-10 has a role in beta-cell survival and is suppressed by RyR2
14974344 Observational study of gene-disease association. (HuGE Navigator)
14749261 variation at CAPN10 in different human populations over a range of phenotypes related to type 2 diabetes
14741193 Observational study of gene-disease association. (HuGE Navigator)
14741193 The results suggest that variation in CAPN10 affects risk of type 2 diabetes in the mestizo population of central Mexico (Mexico City and Orizaba) and in Mexican Americans (Starr County, Texas).
14730479 Meta-analysis of gene-disease association. (HuGE Navigator)
14646187 "Calpain 10 gene has potential for use in predicting the incidence of type 2 diabetes by genetic diagnosis" p.1766
14642065 Observational study of gene-disease association. (HuGE Navigator)
14602801 Observational study of gene-disease association. (HuGE Navigator)
14602801 risk alleles and genotypes, within CAPN10 gene, that could be associated with important phenotypic and prognosis differences observed in polycystic ovary patients.
14574648 confirmation of role in type 2 diabetes susceptibility
14500039 Observational study of gene-disease association. (HuGE Navigator)
12905623 Observational study of gene-disease association. (HuGE Navigator)
12519860 Observational study of gene-disease association. (HuGE Navigator)
12519860 Genetic variations in the 112/121 haplotype combination defined by the UCSNP-43, -19, and -63 alleles in the calpain-10 gene are not a major factor in the occurrence of type 2 diabetes in Japanese.
12453914 Observational study of gene-disease association. (HuGE Navigator)
12453914 Gene frequency of the 112/121 at-risk haplotype of CAPN10 is low among Scandinavians and we were unable to demonstrate significant associations between the CAPN10 variants and type 2 diabetes, insulin resistance, or impaired insulin secretion.
12161543 Observational study of gene-disease association. (HuGE Navigator)
12161543 CAPN10 alleles are associated with polycystic ovary syndrome
12145185 Observational study of gene-disease association. (HuGE Navigator)
12145185 Variation in gene predisposes to insulin resistance and elevated free fatty acid levels.
12137596 Observational study of gene-disease association. (HuGE Navigator)
12137596 detect the association among calpain-10(CAPN-10) gene polymorphism, hypentension and hyperglycemia
12133483 Observational study of gene-disease association. (HuGE Navigator)
12133483 The UCSNP44 variation of calpain 10 gene on NIDDM1 locus and its impact on plasma glucose levels in type 2 diabetic patients
12107745 Observational study of gene-disease association. (HuGE Navigator)
12107745 insulin sensitivity of glucose disposal and lipolysis: no influence of common genetic variants
12107735 Observational study of gene-disease association. (HuGE Navigator)
12107735 investigation of the influence of polymorphisms in the Calpain-10 gene on microvascular function
12107250 Observational study of gene-disease association. (HuGE Navigator)
12107250 Calpain-10 gene polymorphism is associated with reduced beta(3)-adrenoceptor function in human fat cells. a deletion/insertion polymorphism.
12083814 No evidence for involvement of the calpain-10 gene 'high-risk' haplotype combination for non-insulin-dependent diabetes mellitus in early onset obesity.
12050223 Observational study of gene-disease association. (HuGE Navigator)
12050223 Variation within the type 2 diabetes susceptibility gene calpain-10 and polycystic ovary syndrome.
12046551 SNP distribution of CAPN10 gene differs in different Chinese nationalities; studied SNPs in CAPN10 gene may not be the major susceptibility ones of NIDDM in Han people of Northern China
11980626 Observational study of gene-disease association. (HuGE Navigator)
11980626 Homozygous combination of calpain 10 gene haplotypes is associated with type 2 diabetes mellitus in a Polish population.
11978669 Observational study of gene-disease association. (HuGE Navigator)
11978665 Observational study of gene-disease association. (HuGE Navigator)
11935160 Observational study of gene-disease association. (HuGE Navigator)
11935160 polymorphism influences glucose metabolism in human fat cells
11932299 Observational study of gene-disease association. (HuGE Navigator)
11891618 Observational study of genotype prevalence. (HuGE Navigator)
11891618 Geographic and haplotype structure of candidate type 2 diabetes susceptibility variants at the calpain-10 locus.
11891023 Observational study of gene-disease association. (HuGE Navigator)
11891023 polymorphism related to increased serum cholesterol, but not to NIDDM in Japan
11872216 Observational study of gene-disease association. (HuGE Navigator)
11774208 Observational study of gene-disease association. (HuGE Navigator)
11774208 The variation of calpain-10 gene has impact on the variation of clinical metabolic parameter levels related to type 2 diabetes mellitus.
11756349 Observational study of gene-disease association. (HuGE Navigator)
11756346 Observational study of gene-disease association. (HuGE Navigator)
11704924 Observational study of gene-disease association. (HuGE Navigator)
11704924 type 2 diabetes and three calpain-10 gene polymorphisms in Samoans: no evidence of association
11522685 Observational study of gene-disease association. (HuGE Navigator)
11481585 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRAGRGATPARELFRDAAFPAADSSLFCDLSTPLAQFREDITWRRPQEICATPRLFPDDPREGQVKQGLL      1 - 70
GDCWFLCACAALQKSRHLLDQVIPPGQPSWADQEYRGSFTCRIWQFGRWVEVTTDDRLPCLAGRLCFSRC     71 - 140
QREDVFWLPLLEKVYAKVHGSYEHLWAGQVADALVDLTGGLAERWNLKGVAGSGGQQDRPGRWEHRTCRQ    141 - 210
LLHLKDQCLISCCVLSPRAGARELGEFHAFIVSDLRELQGQAGQCILLLRIQNPWGRRCWQGLWREGGEG    211 - 280
WSQVDAAVASELLSQLQEGEFWVEEEEFLREFDELTVGYPVTEAGHLQSLYTERLLCHTRALPGAWVKGQ    281 - 350
SAGGCRNNSGFPSNPKFWLRVSEPSEVYIAVLQRSRLHAADWAGRARALVGDSHTSWSPASIPGKHYQAV    351 - 420
GLHLWKVEKRRVNLPRVLSMPPVAGTACHAYDREVHLRCELSPGYYLAVPSTFLKDAPGEFLLRVFSTGR    421 - 490
VSLSAIRAVAKNTTPGAALPAGEWGTVQLRGSWRVGQTAGGSRNFASYPTNPCFPFSVPEGPGPRCVRIT    491 - 560
LHQHCRPSDTEFHPIGFHIFQVPEGGRSQDAPPLLLQEPLLSCVPHRYAQEVSRLCLLPAGTYKVVPSTY    561 - 630
LPDTEGAFTVTIATRIDRPSIHSQEMLGQFLQEVSIMAVMKT                                631 - 672
//

Text Mined References (148)

PMID Year Title
26376770 2015 Association of Calpain (CAPN) 10 (UCSNP-43, rs3792267) gene polymorphism with elevated serum androgens in young women with the most severe phenotype of polycystic ovary syndrome (PCOS).
25982606 [Association analysis of SNP-63 and indel-19 variant in the calpain-10 gene with polycystic ovary syndrome in women of reproductive age].
25867367 2015 Calpain-10 gene polymorphisms and risk of type 2 diabetes mellitus in Mexican mestizos.
25773692 2015 New evidence for the role of calpain 10 in autosomal recessive intellectual disability: identification of two novel nonsense variants by exome sequencing in Iranian families.
25617558 2014 [SNP-19 genotypic variants of CAPN10 gene and its relation to diabetes mellitus type 2 in a population of Ciudad Juarez, Mexico].
25504243 Variant in CAPN10 gene and environmental factors show evidence of association with excess weight among young people in a Colombian population.
25382134 2015 CAPN10 SNP43 G>A gene polymorphism and type 2 diabetes mellitus in the Asian population: a meta-analysis of 9353 participants.
25327507 2015 A pharmacogenetic association between a variation in calpain 10 (CAPN10) gene and the response to metformin treatment in patients with type 2 diabetes.
25238846 2014 A genetic variant of the CAPN10 gene in Mexican subjects with dyslipidemia is associated with increased HDL-cholesterol concentrations after the consumption of a soy protein and soluble fiber dietary portfolio.
24993116 2014 Common polymorphisms of calpain-10 and the risk of polycystic ovary syndrome in Tunisian population: a case-control study.
24802731 2014 The effect of calpain-10 gene polymorphism on the development of type 2 diabetes mellitus in a Turkish population.
24779302 2014 A case-control study on the association of common variants of CAPN10 gene and the risk of type 2 diabetes in an Iranian population.
24612564 2014 Association of IRS1, CAPN10, and PPARG gene polymorphisms with type 2 diabetes mellitus in the high-risk population of Hyderabad, India.
24429295 2013 Ethnic differences in CAPN10 SNP-19 in type 2 diabetes: a North-West Indian case control study and evidence from meta-analysis.
24377587 2014 Calpain-10 SNP43 and SNP19 polymorphisms and colorectal cancer: a matched case-control study.
24266779 2014 Variation in the calpain-10 gene is not associated with gestational diabetes mellitus.
24034724 2013 Analysis of the structure of calpain-10 and its interaction with the protease inhibitor SNJ-1715.
23994294 2013 Calpain-10 genetic polymorphisms and polycystic ovary syndrome risk: a meta-analysis and meta-regression.
23687414 2013 Oncogene GAEC1 regulates CAPN10 expression which predicts survival in esophageal squamous cell carcinoma.
23262350 2013 The reduction of Calpain-10 expression is associated with risk polymorphisms in obese children.
23021796 Calpain-10 gene polymorphisms in type 2 diabetes and its micro- and macrovascular complications.
22796443 2012 Identification of copy number variation of CAPN10 in Thais with type 2 diabetes by multiplex PCR and denaturing high performance liquid chromatography (DHPLC).
22384174 2012 Association of CAPN10 SNPs and haplotypes with polycystic ovary syndrome among South Indian Women.
21906115 2012 Four polymorphisms of the CAPN 10 gene and their relationship to polycystic ovary syndrome susceptibility: a meta-analysis.
21389182 2011 Calpain-10 interacts with plasma saturated fatty acid concentrations to influence insulin resistance in individuals with the metabolic syndrome.
20923526 2009 Ethnic difference in patients with type 2 diabetes mellitus in inter-East Asian populations: a systematic review and meta-analysis focusing on gene polymorphism.
20881413 2010 Calpain-10 gene polymorphism in type 2 diabetes mellitus patients in the Gaza Strip.
20848425 2011 Calpain 10 gene and laryngeal cancer: a survival analysis.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20667559 2011 Association of calpain 10 gene polymorphisms with type 2 diabetes mellitus in Southern Indians.
20570542 2010 Variants within the calpain-10 gene and relationships with type 2 diabetes (T2DM) and T2DM-related traits among Tunisian Arabs.
20470430 2010 Common polymorphisms of calpain-10 and the risk of Type 2 Diabetes in a Tunisian Arab population: a case-control study.
20406624 2010 Association of CAPN10 gene with insulin sensitivity, glucose tolerance and renal function in essential hypertensive patients.
20368234 2010 Co-existence of risk and protective haplotypes of Calpain 10 gene to type 2 diabetes in the eastern Indian population.
20193213 2009 [Association between calpain-10 gene polymorphism and risk of type 2 diabetes mellitus: a meta analysis].
20178008 2010 Association of diabetes susceptibility gene calpain-10 with pancreatic cancer among smokers.
20142250 2010 Diabetes genes and prostate cancer in the Atherosclerosis Risk in Communities study.
20119856 2010 Haplotype association of calpain 10 gene variants with type 2 diabetes mellitus in an Irish sample.
20075150 2010 Utility of genetic and non-genetic risk factors in prediction of type 2 diabetes: Whitehall II prospective cohort study.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19752882 2010 Association of calpain-10 gene polymorphism and posttransplant diabetes mellitus in kidney transplant patients medicated with tacrolimus.
19688040 2009 Calpain-10 expression is elevated in pancreatic islets from patients with type 2 diabetes.
19643578 2009 Genetic risk factors for type 2 diabetes with pharmacologic intervention in African-American patients with schizophrenia or schizoaffective disorder.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19570442 2009 [Association of the calpain-10 gene polymorphism with glucose metabolism disorder in pregnant women].
19565864 2009 [Single-nucleotide polymorphisms and genotype combinations in calpain-10 gene of gestational diabetes mellitus].
19491387 2009 Severe obesity is associated with novel single nucleotide polymorphisms of the ESR1 and PPARgamma locus in Han Chinese.
19418728 2009 [Effect of the Gly972Arg, SNP43 and Prol2Ala polymorphisms of the genes IRS1, CAPN10 and PPARG2 on secondary failure to sulphonylurea and metformin in patients with type 2 diabetes in Yucatán, México].
19387820 2009 Genetic polymorphisms of FSHR, CYP17, CYP1A1, CAPN10, INSR, SERPINE1 genes in adolescent girls with polycystic ovary syndrome.
19337008 2009 Calpain 10 gene single-nucleotide 44 polymorphism may have an influence on clinical and metabolic features in patients with polycystic ovary syndrome.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19297292 [Study of association of the SNP19 polymorphism of calpain 10 gene with type 2 diabetes in ethnic sub-groups of the Tunisian population: gene-environment interaction].
19193380 2009 Replication of calpain-10 genetic association with carotid intima-media thickness.
19144693 2009 Calpain 10 is required for cell viability and is decreased in the aging kidney.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18722363 2008 Association between CAPN10 UCSNP-43 gene polymorphism and polycystic ovary syndrome in Chilean women.
18701098 2009 111/121 diplotype of Calpain-10 is associated with the risk of polycystic ovary syndrome in Korean women.
18698425 2008 The CAPN10 gene is associated with insulin resistance phenotypes in the Spanish population.
18683748 2008 [Relationship between single nucleotide polymorphism-56 of calpain-10 gene and glucose and lipid metabolism in polycystic ovary syndrome patients].
18554168 2008 Calpain 10 SNP-44 gene polymorphism affects susceptibility to type 2 diabetes mellitus and diabetic-related conditions.
18487065 2008 Association of calpain-10 polymorphisms with type 2 diabetes in the Tunisian population.
18452715 2008 Characterization of endogenous and recombinant human calpain-10.
18367022 2008 Type 2 diabetes candidate gene CAPN10: first, but not last.
18248681 2008 Prevalence of common disease-associated variants in Asian Indians.
18241614 2007 Genetic links between diabetes mellitus and coronary atherosclerosis.
18167206 2007 Variations in the calpain-10 gene are associated with the risk of type 2 diabetes and hypertension in northern Han Chinese population.
17964829 The activity of calpains in lymphocytes is glucose-dependent and is decreased in diabetic patients.
17855447 2007 Common genetic variation in calpain-10 gene (CAPN10) and diabetes risk in a multi-ethnic cohort of American postmenopausal women.
17601994 2007 Variants of the transcription factor 7-like 2 (TCF7L2) gene are associated with type 2 diabetes in an African-American population enriched for nephropathy.
17572128 2007 Targeted suppression of calpain-10 expression impairs insulin-stimulated glucose uptake in cultured primary human skeletal muscle cells.
17570749 2005 Genetic prediction of future type 2 diabetes.
17560157 2007 Coordinated control of both insulin secretion and insulin action through calpain-10-mediated regulation of exocytosis?
17559371 2007 Identification of a protective haplogenotype within CAPN10 gene influencing colorectal cancer susceptibility.
17511963 2007 CAPN10 mRNA splicing and decay is not affected by a SNP associated with susceptibility to type 2 diabetes.
17454172 2007 CAPN10 UCSNP-43, UCSNP-19 and UCSNP-63 polymorphisms and metabolic syndrome in polycystic ovary syndrome.
17382509 2008 CAPN10 alleles modify laryngeal cancer risk in the Spanish population.
17106059 2007 Calpain-10 variants and haplotypes are associated with polycystic ovary syndrome in Caucasians.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16873988 2006 Calpain-10 (NIDDM1) as a Susceptibility Gene for Common Type 2 Diabetes.
16857402 2006 Variation in CAPN10 in relation to type 2 diabetes, obesity and quantitative metabolic traits: studies in 6018 whites.
16837224 Association of the calpain-10 gene with type 2 diabetes in Europeans: results of pooled and meta-analyses.
16790502 2006 Calpain 10: a mitochondrial calpain and its role in calcium-induced mitochondrial dysfunction.
16752174 2006 Common polymorphisms of calpain-10 are associated with abdominal obesity in subjects at high risk of type 2 diabetes.
16721485 2006 A novel 111/121 diplotype in the Calpain-10 gene is associated with type 2 diabetes.
16546286 2006 Haplotype combination of Calpain-10 gene polymorphism is associated with metabolic syndrome in type 2 diabetes.
16456802 2006 [Single nucleotide polymorphisms and genotype combinations in calpain-10 gene of Korean population].
16427731 Polymorphisms of interleukin-6, hepatic lipase and calpain-10 genes, and preeclampsia.
16377260 2006 Calpain 10 and development of diabetes mellitus in cystic fibrosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16333311 2006 Hidden population substructures in an apparently homogeneous population bias association studies.
16306378 2005 Patterns of linkage disequilibrium in the type 2 diabetes gene calpain-10.
16186407 2005 Genetic and nongenetic regulation of CAPN10 mRNA expression in skeletal muscle.
16028216 Calpain-10: from genome search to function.
15926113 2005 Genetic determinants of insulin action in polycystic ovary syndrome.
15862281 2005 Calpain inhibition and insulin action in cultured human muscle cells.
15860244 2005 Variants of calpain-10 gene and its association with type 2 diabetes mellitus in a Chinese population.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15793266 2005 Association of the diabetes gene calpain-10 with subclinical atherosclerosis: the Mexican-American Coronary Artery Disease Study.
15696376 2005 Genetic variants in the calpain-10 gene and the development of type 2 diabetes in the Japanese population.
15652721 2005 Calpain-10 gene polymorphisms and type 2 diabetes in West Africans: the Africa America Diabetes Mellitus (AADM) Study.
15641690 2004 Relationship between calpain-10 gene polymorphism and insulin resistance phenotypes in Chinese.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471947 2005 Evidence that an isoform of calpain-10 is a regulator of exocytosis in pancreatic beta-cells.
15240652 2004 Variation in the calpain-10 gene is associated with elevated triglyceride levels and reduced adipose tissue messenger ribonucleic acid expression in obese Swedish subjects.
15172858 2004 Calpain-10 haplotype combination and association with gestational diabetes mellitus.
15044459 2004 RyR2 and calpain-10 delineate a novel apoptosis pathway in pancreatic islets.
14974344 2003 Calpain 10 gene polymorphisms and the risk of ischaemic stroke in a Polish population.
14759258 2004 An unappreciated role for RNA surveillance.
14749261 2004 Linkage of calpain 10 to type 2 diabetes: the biological rationale.
14741193 2004 Association of the calpain-10 gene with type 2 diabetes mellitus in a Mexican population.
14730479 2004 Are variants in the CAPN10 gene related to risk of type 2 diabetes? A quantitative assessment of population and family-based association studies.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14646187 2003 Calpain 10 as a predictive gene for type 2 diabetes: evidence from a novel screening system using white blood cells of Otsuka Long-Evans Tokushima Fatty (OLETF) rats.
14642065 2003 [Study on Calpain10 gene polymorphism in Chinese type 2 diabetes families].
14602801 2003 Specific CAPN10 gene haplotypes influence the clinical profile of polycystic ovary patients.
14574648 2003 Meta-analysis and a large association study confirm a role for calpain-10 variation in type 2 diabetes susceptibility.
14500039 2003 Association of the SNP-19 genotype 22 in the calpain-10 gene with elevated body mass index and hemoglobin A1c levels in Japanese.
12974673 2003 Calpain facilitates GLUT4 vesicle translocation during insulin-stimulated glucose uptake in adipocytes.
12905623 2002 [Single nucleotide polymorphisms in CAPN10 gene of Chinese population and its correlation with type 2 diabetes mellitus in Han people of northern China].
12519860 2003 Genetic variations in calpain-10 gene are not a major factor in the occurrence of type 2 diabetes in Japanese.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453914 2002 Variants within the calpain-10 gene on chromosome 2q37 (NIDDM1) and relationships to type 2 diabetes, insulin resistance, and impaired acute insulin secretion among Scandinavian Caucasians.
12161543 2002 Comment: CAPN10 alleles are associated with polycystic ovary syndrome.
12137596 2002 [Relationship between calpain-10 gene polymorphism, hypertension and plasma glucose].
12133483 2002 [The UCSNP44 variation of calpain 10 gene on NIDDM1 locus and its impact on plasma glucose levels in type 2 diabetic patients].
12107745 2002 Insulin sensitivity of glucose disposal and lipolysis: no influence of common genetic variants in IRS-1 and CAPN10.
12107735 2002 Association of calpain-10 gene with microvascular function.
12083814 2002 No evidence for involvement of the calpain-10 gene 'high-risk' haplotype combination for non-insulin-dependent diabetes mellitus in early onset obesity.
12046551 2002 Single nucleotide polymorphisms in CAPN10 gene of Chinese people and its correlation with type 2 diabetes mellitus in Han people of northern China.
11980626 2002 Homozygous combination of calpain 10 gene haplotypes is associated with type 2 diabetes mellitus in a Polish population.
11978669 2002 Variation in three single nucleotide polymorphisms in the calpain-10 gene not associated with type 2 diabetes in a large Finnish cohort.
11978665 2002 Haplotype combinations of calpain 10 gene polymorphisms associate with increased risk of impaired glucose tolerance and type 2 diabetes in South Indians.
11932299 2002 Relationship of calpain-10 genotype to phenotypic features of polycystic ovary syndrome.
11891023 2002 Calpain 10 gene polymorphisms are related, not to type 2 diabetes, but to increased serum cholesterol in Japanese.
11872216 2002 Common single nucleotide polymorphisms in intron 3 of the calpain-10 gene influence hirsutism.
11836299 2002 Role of calpain-10 gene variants in familial type 2 diabetes in Caucasians.
11774208 2001 [The impact of calpain-10 gene combined-SNP variation on type 2 diabetes mellitus and its related metabolic traits].
11756349 2002 Variation in the calpain-10 gene affects blood glucose levels in the British population.
11756346 2002 SNP43 of CAPN10 and the risk of type 2 Diabetes in African-Americans: the Atherosclerosis Risk in Communities Study.
11736815 2001 Assignment of the porcine calpain-10 gene (CAPN10) to chromosome 15q23-26.
11522685 2001 Functional significance of the UCSNP-43 polymorphism in the CAPN10 gene for proinsulin processing and insulin secretion in nondiabetic Germans.
11481585 2001 Studies of association between the gene for calpain-10 and type 2 diabetes mellitus in the United Kingdom.
11375982 2001 Characterization and expression of calpain 10. A novel ubiquitous calpain with nuclear localization.
11350192 2001 Reduced skeletal muscle calpain-10 transcript level is due to a cumulative decrease in major isoforms.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
11018080 2000 A calpain-10 gene polymorphism is associated with reduced muscle mRNA levels and insulin resistance.
11017071 2000 Genetic variation in the gene encoding calpain-10 is associated with type 2 diabetes mellitus.
9396712 1997 Structure and physiological function of calpains.