Property Summary

NCBI Gene PubMed Count 146
PubMed Score 331.82
PubTator Score 233.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.234 1.1e-03
atypical teratoid / rhabdoid tumor 1.200 2.0e-05
Atopic dermatitis 1.200 2.0e-03
diabetes mellitus -1.200 1.2e-03
interstitial cystitis -1.400 1.3e-04

Gene RIF (103)

PMID Text
27036949 This study demonstrated that Upregulation of calpain activity precedes tau phosphorylation and loss of synaptic proteins in Alzheimer's disease brain.
26974309 the calpain-dependent cleavage of Nav1.6 channels expressed in human embryonic kidney (HEK) 293 cells caused the upregulation of I(NaP)
26317226 Increased mu-Calpain Activity in Blasts of Common B-Precursor Childhood Acute Lymphoblastic Leukemia Correlates with Their Lower Susceptibility to Apoptosis.
26284543 NOS stimulation via PI3K, calpain proteases, and SIRT1-dependent deacetylation downstream from VEGFR2 activation contributes to these vasodilator responses.
26172506 Data indicate that calpain is responsible for processing translation termination factor eRF3 into its IAP-binding isoform p-eRF3.
26063807 Junctophilin-2 is cleaved by calpain at multiple sites, resulting in dysfunctional junctophilin-2 truncations.
25918155 findings suggest that truncation/activation of Dyrk1A by Ca(2+)/calpain I might contribute to Tau pathology via promotion of exon 10 exclusion and hyperphosphorylation of Tau in AD brain
25476568 The results of this study indicated that reductions in kallikrein-6 and calpain-1 may contribute to the accumulation of alpha-synuclein in DLB.
25336645 CAPN1 anchors to two NCX1 regions and cleaves at methionine-369, leading to NCX1 inactivation in heart failure.
25309925 5-LOX inhibition reduced apoptotic death, restored the initial IL-2/INF-gamma ratio, and more importantly reverted micro-calpain activation induced by simulated microgravity.
25086406 Data show the X-ray structures of calpain with (Z)-3-(4-chlorophenyl)-2-mercaptoacrylic acid and (Z)-3-(5-bromoindol-3-yl)-2-mercaptoacrylic acid.
24691096 the p12/Pol delta is a target as a nuclear substrate of mu-calpain in a calcium-triggered apoptosis and appears to be a potential marker in the study of the chemotherapy of cancer therapies.
24670325 Besides, calpain-1, a calcium-dependent cysteine protease, was involved inherpes simplex virus type 1 intracellular trafficking.
24416790 The PC1 function on JAK2 and ERK signaling pathways might be regulated by calpains in response to the changes in intracellular calcium concentration.
24413738 Increased trophoblast apoptosis and altered expression levels of syncytin-1, calpain 1, and AIF is observed in preeclamptic placentas.
24359561 Calpain-mediated cleavage of HIV-1 Tat occurs in the C-terminus of this viral protein, between amino acids 68 and 69. The cleavage of Tat by calpain 1 increases neurotoxic effect of this viral protein
23919677 Ayloid beta mediates calpain cleavage of NCX3 in Alzheimer's disease brain.
23733271 Small interfering RNA (siRNA)-mediated silencing of micro-calpain expression significantly suppressed the adhesive, migrative and invasive potentials of human hepatoma cells.
23707532 HER2 inhibited calpain-1 activity through upregulating calpastatin, an endogenous calpain inhibitor.
23515028 Calpain activation via Ca(2) flux plays an essential role in eliciting an AIF-mediated, caspase-independent apoptotic pathway in EV71-infected cells.
23408424 Extracellular signal-regulated kinase and glycogen synthase kinase 3beta regulate gephyrin postsynaptic aggregation and GABAergic synaptic function in a calpain-dependent mechanism
23400779 a truncated fragment of Src protein kinase generated by calpain-mediated cleavage is a mediator of neuronal death in excitotoxicity
23289183 Proteolysis of calcineurin A by endogenous calpain I leads to the formation of constitutively active calcineurin in the human heart, which may contribute to the pathogenesis of myocardial disease
23006733 Data indicate that calpain-1 plays a pivotal role in matrix metalloproteinase 2 (MMP2) activation and extracellular matrix remodeling, including fibrosis and vascular calcification.
22480599 APP secretion from the calpain overexpressing cells was robustly increased under both resting and stimulated conditions over wild-type cells.
22477191 Report synthesis of emodin derivatives, emodin carbaldehyde, citreorosein, and their 10-deoxygenated derivatives and their inhibitory activities on mu-calpain.
22449977 Results show that estrogen may contribute to both up-regulation and proteolysis of cyclin E through calpain in MCF-7 cells.
22335024 With higher grading of the ovarian carcinoma, staining intensity and immunoreactive score of calpain 1 decreased.
21880013 Data show that mRNA levels of the two main lysosomal enzymes (cathepsin B and L) were not changed but, conversely, genes related to calpain and caspase had a higher expression in the muscles of the patients.
21876002 Rad21 cleavage by calpain-1 promotes separation of chromosome arms, which coincides with a calcium-induced partial loss of cohesin at several chromosomal loci.
21839844 The expression of mu-calpain-induced degradation products of extracellular matrix was correlated with the degree of disc degeneration in human intervertebral disc tissue
21825064 H. pylori activates calpain via TLR2 to disrupt gastric epithelial adherens junctions structure.
21808066 it is possible to protect cells from paclitaxel-induced degradation of NCS-1 by inhibiting calpain activity
21555338 siRNA knockdown of calpain prevented deltamethrin-induced DNA fragmentation.
21531719 calpain 1 is essential for the proteolytic processing of FLG2 and that deimination accelerates this process.
21516125 Findings show that p73alpha and its regulation by the Ca(2+)-mediated calpain pathway are involved in CDDP-induced apoptosis in OVCA cells and that dysregulation of Ca(2+)/calpain/p73 signaling may in part be the pathophysiology of CDDP resistance.
21494752 Data show neutrophil calpain I (mu-calpain) was inactiveted by alpha1-antitrypsin.
21442128 Results show high levels of the 17-kDa tau fragment and enhanced calpain activity in the temporal cortex of AD patients and in brain samples obtained from patients with other tauopathies.
21374734 Data show that transfection of cells with GRP78 or calpain I and calpain II siRNA reduced MPTB-mediated cell apoptosis in chondrosarcoma JJ012 cells
21315622 Overexpression of mu-calpain in the anterior temporal neocortex is associated with intractable epilepsy as well as the clinicopathological characteristics in these patients.
21305563 Increased calpain activity in skeletal muscle may be an early response to cancer that occurs before activation of the ubiquitin-proteasome pathway and loss of muscle mass has become evident.
21268016 The expression of both CAPN 1 and CAPNS 1 is increased in transplant kidneys with acute rejection, and increased expression of CAPN 1 alone was observed in kidneys with chronic rejection.
21209906 analysis of molecular determinants of survival motor neuron (SMN) protein cleavage by the calcium-activated protease, calpain
20962236 Calpain-mediated cleavage of HIV-1 Tat occurs in the C-terminus of this viral protein, between amino acids 68 and 69. The cleavage of Tat by calpain 1 increases neurotoxic effect of this viral protein
20933204 the role of calpain in diabetes; analyze the role of calpain in platelet activation (Review)
20659425 TGase 2-mu-calpain system is significant in the NF-kappaB pathway via I-kappaBalpha polymerization and subsequent degradation.
20557290 Calpain regulated CFTR turnover.
20518497 Fanconi anemia proteins may play an important role in maintaining the stability of alphaIISp in the cell by regulating its cleavage by mu-calpain.
20514436 Data show that in patients with CHF, calpain upregulation was associated with an increase in cleavage of cain/cabin1 and the activation of CaN.
20398180 These results suggest that calpain-dependent cleavage of SHP-1 and SHP-2 may contribute to protein tyrosine dephosphorylation in Jurkat T cell death induced by Entamoeba histolytica.
20193680 High mu-calpain expression is associated with rhabdomyosarcoma aggressiveness.
20041182 The calcium-calpain-caspase-12-caspase-3 cascade is altered in F508del-CFTR expressing cells.
20034566 Here, we provide evidence to support a role for the involvement of calpain 1 in mitochondrial-induced neurodegeneration in a Parkinson's disease (PD) cellular model.
19946330 Calpain regulates sensitivity to trastuzumab and survival in HER2-positive breast cancer. Calpain as a new therapeutic target in HER2-positive breast cancer.
19901552 Calpain1 plays an important role in controlling the levels of autophagy in normal living cells by regulating the levels of a key signaling molecule, ATG12-ATG5 conjugate.
19617626 the calpain-activated form of caspase-7 has unique enzymatic activity, localization, and binding affinity when compared with the caspase-activated form
19457105 Thus, the formation of clusters containing HSP90, mu-calpain, nNOS and NMDA-R represents the limiting step for the operation of the mechanism that links an efficient synthesis of NO to a local increase in Ca(2+) influx.
19022302 Calpain-mediated cleavage of HIV-1 Tat occurs in the C-terminus of this viral protein, between amino acids 68 and 69. The cleavage of Tat by calpain 1 increases neurotoxic effect of this viral protein
18823990 degradation of human cTnT is mediated by calpain and not by caspases or proteasome
18806756 These results provide novel insights into the mechanism of AIF release during cell death.
18793761 Proof of concept that the calpastatin-based reagents may be useful to selectively detect the active conformation of calpain.
18726991 These results demonstrate calpain involvement in proteasome inhibitor-induced AR breakdown, and suggest that AR degradation is intrinsic to the induction of apoptosis in prostate cancer cells.
18624772 Reduced eNOS protein levels were accompanied by an increase in intracellular Ca(2+), augmented production of reactive oxygen species (ROS) and induction of Ca(2+)-dependent calpain activity.
18498295 genetically determined IL-1alpha levels may modulate transcription of calpain and calpastatin.
18468730 The above suggests that cleavage of DAT by calpain may significantly modify dopamine homeostasis under pathological or physiological conditions.
18165173 The activity of calpain in human peripheral blood lymphocytes, was estimated by assessing the levels of limited proteolysis of calpastatin.
18085799 Protein adducts of iso[4]levuglandin E2 (iso[4]LGE2), a highly reactive product of free radical-induced lipid oxidation, accumulate in human glaucomatous trabecular meshwork (TM) but not in controls.
18071073 platelets from patients with type 2 diabetes mellitus, were found to have enhanced tyrosine nitration and inactivation of the sarcoplasmic endoplasmic reticulum Ca2+-ATPase (SERCA-2), elevated platelet [Ca2+]i, and activation of mu-calpain.
18070881 calpain 1 N-terminus is a mitochondrial targeting sequence
18032503 both calpain 1 and calpain 2 are essential for the replication of EV1 RNA.
17977825 Calpain emerges as a central player in E7-mediated degradation of Rb
17908236 In patients with Alzheimer disease, over-activation of calpain because of calcium dysregulation causes increased degradation and thus decreased activity of PKA, which, in turn, contributes to down-regulation of CREB and impaired cognition and memory.
17897354 Calpain-mediated cleavage of HIV-1 Tat occurs in the C-terminus of this viral protein, between amino acids 68 and 69. The cleavage of Tat by calpain 1 increases neurotoxic effect of this viral protein
17765980 Taken together, these results suggested calpain involvement in Th1/Th2 dysregulation in MS patients.
17716656 These findings pinpoint calpain-1 as a regulator of Frizzled-7 turnover at the plasma membrane and reveal a link between Frizzled-7 cleavage and its activity.
17690304 Nitric oxide-induced motility in osteoclasts requires regulated Ca(2+) release, which activates mu-calpain. This occurs via the Ins(1,4,5)P(3)R1.
17359359 association between mu- and m-calpain, the specific inhibitor calpastatin, and axonal injury in post mortem brain tissue from patients who died from severe malaria
17195093 Results suggest that calpains are involved in hypoxia-induced necrotic cell death, and that the inhibition of calpain switches hypoxia-induced cell death to apoptotic cell death without affecting cell viability.
17157313 We have solved the structures of human calpain 1 and calpain 9 protease cores ; both structures have clear implications for the function of non-catalytic domains of full-length calpains in the calcium-mediated activation of the enzyme.
17121855 phosphorylation of Thr(138) predominantly defines the susceptibility of p35 to calpain-dependent cleavage and dephosphorylation of this site is a critical determinant of Cdk5-p25-induced cell death associated with neurodegeneration
16908521 Acyl coenzyme A-binding protein has a role in augmenting bid-induced mitochondrial damage and cell death by activating mu-calpain
16740134 In vitro membrane binding of mu-calpain is due to the exposed hydrophobic surface of the active conformation and does not reduce the Ca2+ requirement for activation.
16697376 Knockdown of mu-calpain decreased the proteolytic products of filamin and talin suggesting that their proteolysis could be one of the key mechanisms by which mu-calpain regulates cell migration.
16598790 beside its known effect on general muscle protein degradation, calpain contributes to Duchenne muscular dystrophy pathology by specifically degrading the compensatory protein utrophin
16361262 a novel role for PKCiota as a nicotine-activated, physiological calpain kinase that directly phosphorylates and activates calpains.
16150694 The activation of calcineurin by calpain I in the brain of patients with Alzheimer's disease is reported.
16107503 the time- and concentration-dependent changes in [Ca2+]i that occurred during concentric exercise fall near but below the level necessary to cause autolysis of calpains in vivo
15975558 calpains may play a physiological role in the regulation of p73 protein stability
15950654 Immunohistochemistry of fixed, permeabilized oocytes exhibit localization of calpain mu isoform to the cortical region of the oocyte, as well as the cytosol.
15948206 These observations indicate that calpain is activated and reacts with alpha-fodrin as a substrate at the sarcolemma, and plays a key role in modulating sarcolemmal proteins to adapt to the specific conditions in each myopathy
15809056 mu-calpain, is a potential candidate for alpha-secretase in the regulated Alzheimer's beta-amyloid precursor protein alpha-processing
15663601 Mu-calpain is activated in human endometrial cells during hypoxia and that subsequent cleavage of the integrin beta3 cytoplasmic domain may give some adverse effects to the function of human endometrium
15590628 Both precursor and mature forms of recombinant AIF were cleaved near the amino terminus by calpain I in vitro
15488707 Epidermal growth factor activates m-calpain, which causes apoptosis of HaCaT keratinocytes
15471877 nitrosamine 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone-induced cell migration and invasion may occur, at least in part, through a novel mechanism involving phosphorylation of calpains that leads to their activation and secretion
15302874 calpain I and II, calpastatin, and the regulatory subunit localize to the cytosolic surface of the endoplasmic reticulum and Golgi apparatus membranes
15131115 platelet FXIII and calpain have roles in regulating integrin alpha(IIb)beta3 adhesive function
14980313 mu-calpain and m-calpain expression may be compromised in the anterior vaginal wall of women with uterovaginal prolapse
14612448 calpastatin and calpain-1 represent critical proximal elements in a cascade of pro-apoptotic events leading to Bax, mitochondria, and caspase-3 activation
12393869 investigates whether E-cadherin is a substrate for calpain and whether calpain-dependent proteolysis was associated with prostate cancer progression
12121992 cleaves SNAP-23 in activated platelets
11861304 Calpain (mu-calpain) is a signal transducer and activator of transcription (STAT) 3 and STAT5 protease.
8954122 Calpain-mediated cleavage of HIV-1 Tat occurs in the C-terminus of this viral protein, between amino acids 68 and 69. The cleavage of Tat by calpain 1 increases neurotoxic effect of this viral protein

AA Sequence

MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGY      1 - 70
KDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQS     71 - 140
FQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGST    141 - 210
SEGFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAK    211 - 280
QVNYRGQVVSLIRMRNPWGEVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEI    281 - 350
CNLTPDALKSRTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV    351 - 420
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINLREVSTRFRLP    421 - 490
PGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSEEEIDENFKALFRQLAGEDME    491 - 560
ISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRDGNGKLGLVEFNILWNRIRNYLSIFRKFDLD    561 - 630
KSGSMSAYEMRMAIESAGFKLNKKLYELIITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVV    631 - 700
TFDLFKWLQLTMFA                                                            701 - 714
//

Text Mined References (156)

PMID Year Title
27036949 2016 Upregulation of calpain activity precedes tau phosphorylation and loss of synaptic proteins in Alzheimer's disease brain.
26974309 2016 Cleavage of Na(+) channels by calpain increases persistent Na(+) current and promotes spasticity after spinal cord injury.
26317226 2015 Increased ?-Calpain Activity in Blasts of Common B-Precursor Childhood Acute Lymphoblastic Leukemia Correlates with Their Lower Susceptibility to Apoptosis.
26284543 2015 VEGF Receptor-2-Linked PI3K/Calpain/SIRT1 Activation Mediates Retinal Arteriolar Dilations to VEGF and Shear Stress.
26172506 2015 Calpain mediates processing of the translation termination factor eRF3 into the IAP-binding isoform p-eRF3.
26063807 2015 Molecular Determinants of Calpain-dependent Cleavage of Junctophilin-2 Protein in Cardiomyocytes.
25918155 2015 Truncation and Activation of Dual Specificity Tyrosine Phosphorylation-regulated Kinase 1A by Calpain I: A MOLECULAR MECHANISM LINKED TO TAU PATHOLOGY IN ALZHEIMER DISEASE.
25476568 2014 Accumulation of ?-synuclein in dementia with Lewy bodies is associated with decline in the ?-synuclein-degrading enzymes kallikrein-6 and calpain-1.
25336645 2014 Molecular basis of calpain cleavage and inactivation of the sodium-calcium exchanger 1 in heart failure.
25309925 2014 A functional interplay between 5-lipoxygenase and ?-calpain affects survival and cytokine profile of human Jurkat T lymphocyte exposed to simulated microgravity.
25086406 2014 The structural basis of differential inhibition of human calpain by indole and phenyl ?-mercaptoacrylic acids.
24691096 2014 Proteolysis of the human DNA polymerase delta smallest subunit p12 by ?-calpain in calcium-triggered apoptotic HeLa cells.
24670325 2014 Calcium-signal facilitates herpes simplex virus type 1 nuclear transport through slingshot 1 and calpain-1 activation.
24416790 2014 Calpain-mediated proteolysis of polycystin-1 C-terminus induces JAK2 and ERK signal alterations.
24413738 2014 Reduced syncytin-1 expression in choriocarcinoma BeWo cells activates the calpain1-AIF-mediated apoptosis, implication for preeclampsia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23919677 2014 Calpain cleavage and inactivation of the sodium calcium exchanger-3 occur downstream of A? in Alzheimer's disease.
23733271 2013 Calpains are required for invasive and metastatic potentials of human HCC cells.
23707532 2013 HER2 regulates Brk/PTK6 stability via upregulating calpastatin, an inhibitor of calpain.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23515028 2013 Calcium flux and calpain-mediated activation of the apoptosis-inducing factor contribute to enterovirus 71-induced apoptosis.
23408424 2013 Extracellular signal-regulated kinase and glycogen synthase kinase 3? regulate gephyrin postsynaptic aggregation and GABAergic synaptic function in a calpain-dependent mechanism.
23400779 2013 A truncated fragment of Src protein kinase generated by calpain-mediated cleavage is a mediator of neuronal death in excitotoxicity.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23289183 2012 Proteolysis by endogenous calpain I leads to the activation of calcineurin in human heart.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23006733 2012 Calpain-1 regulation of matrix metalloproteinase 2 activity in vascular smooth muscle cells facilitates age-associated aortic wall calcification and fibrosis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22805611 2012 Advanced glycation end-products induce calpain-mediated degradation of ezrin.
22480599 2012 Evidence supporting the role of calpain in the ?-processing of amyloid-? precursor protein.
22477191 2012 A facile synthesis of emodin derivatives, emodin carbaldehyde, citreorosein, and their 10-deoxygenated derivatives and their inhibitory activities on ?-calpain.
22449977 2012 17beta-estradiol induces both up-regulation and processing of cyclin E in a calpain-dependent manner in MCF-7 breast cancer cells.
22335024 2011 Immunhistochemical analysis for expression of calpain 1, calpain 2 and calpastatin in ovarian cancer.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21880013 2012 Protein metabolism and gene expression in skeletal muscle of critically ill patients with sepsis.
21876002 2011 Calpain-1 cleaves Rad21 to promote sister chromatid separation.
21839844 2011 Abundance of calpain and aggrecan-cleavage products of calpain in degenerated human intervertebral discs.
21825064 2011 Helicobacter pylori activates calpain via toll-like receptor 2 to disrupt adherens junctions in human gastric epithelial cells.
21808066 2011 Protection of neuronal calcium sensor 1 protein in cells treated with paclitaxel.
21555338 2011 Mechanism of pyrethroid pesticide-induced apoptosis: role of calpain and the ER stress pathway.
21531719 2011 Deimination of human filaggrin-2 promotes its proteolysis by calpain 1.
21516125 2011 P73 regulates cisplatin-induced apoptosis in ovarian cancer cells via a calcium/calpain-dependent mechanism.
21494752 Acute-phase protein ?1-antitrypsin inhibits neutrophil calpain I and induces random migration.
21442128 2011 Calpain-mediated tau cleavage: a mechanism leading to neurodegeneration shared by multiple tauopathies.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21374734 2011 The novel benzimidazole derivative, MPTB, induces cell apoptosis in human chondrosarcoma cells.
21315622 2011 Overexpression of ?-calpain in the anterior temporal neocortex of patients with intractable epilepsy correlates with clinicopathological characteristics.
21305563 2011 Calpain activity is increased in skeletal muscle from gastric cancer patients with no or minimal weight loss.
21269460 2011 Initial characterization of the human central proteome.
21268016 2011 Critical role of the calpain/calpastatin balance in acute allograft rejection.
21209906 2010 Molecular determinants of survival motor neuron (SMN) protein cleavage by the calcium-activated protease, calpain.
20933204 2010 The role of calpain in diabetes-associated platelet hyperactivation.
20659425 2010 I-kappaBalpha depletion by transglutaminase 2 and mu-calpain occurs in parallel with the ubiquitin-proteasome pathway.
20557290 2010 Role of calpain in the regulation of CFTR (cystic fibrosis transmembrane conductance regulator) turnover.
20518497 2010 Knockdown of mu-calpain in Fanconi anemia, FA-A, cells by siRNA restores alphaII spectrin levels and corrects chromosomal instability and defective DNA interstrand cross-link repair.
20514436 2010 Increased expression of calpain and elevated activity of calcineurin in the myocardium of patients with congestive heart failure.
20398180 2010 Calpain-dependent cleavage of SHP-1 and SHP-2 is involved in the dephosphorylation of Jurkat T cells induced by Entamoeba histolytica.
20193680 2010 Calpains: markers of tumor aggressiveness?
20041182 2009 The calpain, caspase 12, caspase 3 cascade leading to apoptosis is altered in F508del-CFTR expressing cells.
20034566 2010 Dysfunctional mitochondria uphold calpain activation: contribution to Parkinson's disease pathology.
19946330 2010 Calpain regulates sensitivity to trastuzumab and survival in HER2-positive breast cancer.
19901552 2010 Control of basal autophagy by calpain1 mediated cleavage of ATG5.
19712109 2009 Calpain-mediated degradation of reversibly oxidized protein-tyrosine phosphatase 1B.
19617626 2009 Calpain-1 cleaves and activates caspase-7.
19457105 2009 Calpain-mediated activation of NO synthase in human neuroblastoma SK-N-BE cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18823990 2008 Calpain mediates cardiac troponin degradation and contractile dysfunction in atrial fibrillation.
18806756 2008 An increase in intracellular Ca2+ is required for the activation of mitochondrial calpain to release AIF during cell death.
18793761 2008 Detecting the active conformation of calpain with calpastatin-based reagents.
18726991 2008 Calpain-mediated androgen receptor breakdown in apoptotic prostate cancer cells.
18624772 2009 Activation of protease calpain by oxidized and glycated LDL increases the degradation of endothelial nitric oxide synthase.
18498295 2008 Complex effects of IL1A polymorphism and calpain inhibitors on interleukin 1 alpha (IL-1 alpha) mRNA levels and secretion of IL-1 alpha protein.
18468730 2008 Truncation of human dopamine transporter by protease calpain.
18165173 2007 Ex vivo measurement of calpain activation in human peripheral blood lymphocytes by detection of immunoreactive products of calpastatin degradation.
18085799 2008 Isolevuglandin-modified proteins, including elevated levels of inactive calpain-1, accumulate in glaucomatous trabecular meshwork.
18071073 2008 Platelet sarcoplasmic endoplasmic reticulum Ca2+-ATPase and mu-calpain activity are altered in type 2 diabetes mellitus and restored by rosiglitazone.
18070881 2008 N terminus of calpain 1 is a mitochondrial targeting sequence.
18032503 2008 Calpain 1 and 2 are required for RNA replication of echovirus 1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17977825 2007 Human papillomavirus E7 requires the protease calpain to degrade the retinoblastoma protein.
17908236 2007 Down-regulation of cAMP-dependent protein kinase by over-activated calpain in Alzheimer disease brain.
17765980 2007 Increased calpain correlates with Th1 cytokine profile in PBMCs from MS patients.
17716656 2007 Frizzled-7 turnover at the plasma membrane is regulated by cell density and the Ca(2+) -dependent protease calpain-1.
17690304 2007 Necessity of inositol (1,4,5)-trisphosphate receptor 1 and mu-calpain in NO-induced osteoclast motility.
17359359 2007 Cerebral calpain in fatal falciparum malaria.
17264674 2007 The calpain system as a modulator of stress/damage response.
17195093 2007 Hypoxia-induced cell death of HepG2 cells involves a necrotic cell death mediated by calpain.
17157313 2007 The crystal structures of human calpains 1 and 9 imply diverse mechanisms of action and auto-inhibition.
17121855 2007 Suppression of calpain-dependent cleavage of the CDK5 activator p35 to p25 by site-specific phosphorylation.
16908521 2006 Acyl coenzyme A-binding protein augments bid-induced mitochondrial damage and cell death by activating mu-calpain.
16740134 2006 Mu-calpain binds to lipid bilayers via the exposed hydrophobic surface of its Ca2+-activated conformation.
16697376 2006 Functional dissection of human protease mu-calpain in cell migration using RNAi.
16598790 2006 Utrophin is a calpain substrate in muscle cells.
16411745 2006 Molecular mode of action of a covalently inhibiting peptidomimetic on the human calpain protease core.
16361262 2006 Protein kinase Ciota promotes nicotine-induced migration and invasion of cancer cells via phosphorylation of micro- and m-calpains.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16150694 2005 Truncation and activation of calcineurin A by calpain I in Alzheimer disease brain.
16107503 2006 mu-Calpain and calpain-3 are not autolyzed with exhaustive exercise in humans.
15975558 2005 Calpain cleavage regulates the protein stability of p73.
15950654 2005 Expression and immunolocalization of the calpain-calpastatin system in the human oocyte.
15948206 2005 Calpain-dependent alpha-fodrin cleavage at the sarcolemma in muscle diseases.
15935327 2005 Raf-1 is a binding partner of DSCR1.
15809056 2005 Mu-calpain is functionally required for alpha-processing of Alzheimer's beta-amyloid precursor protein.
15663601 2004 Cleavage of integrin by mu-calpain during hypoxia in human endometrial cells.
15590628 2005 Calpain I induces cleavage and release of apoptosis-inducing factor from isolated mitochondria.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488707 2004 Epidermal growth factor activates m-calpain, resulting in apoptosis of HaCaT keratinocytes.
15471877 2004 Tobacco-specific nitrosamine 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone induces phosphorylation of mu- and m-calpain in association with increased secretion, cell migration, and invasion.
15302874 2004 Differential compartmentalization of the calpain/calpastatin network with the endoplasmic reticulum and Golgi apparatus.
15131115 2004 Platelet factor XIII and calpain negatively regulate integrin alphaIIbbeta3 adhesive function and thrombus growth.
14980313 2004 Different expression of calpains in the anterior vaginal wall of women with and without uterovaginal prolapse.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612448 2004 Calpain-1 regulates Bax and subsequent Smac-dependent caspase-3 activation in neutrophil apoptosis.
14559243 2003 Association of the calpain/calpastatin network with subcellular organelles.
12843408 2003 The calpain system.
12684003 2003 A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
12591934 2003 Subcellular localization and in vivo subunit interactions of ubiquitous mu-calpain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432277 p53 Antiproliferative function is enhanced by aspartate substitution at threonine 18 and serine 20.
12393869 2003 The role of calpain in the proteolytic cleavage of E-cadherin in prostate and mammary epithelial cells.
12358155 2002 Screening the proteins that interact with calpain in a human heart cDNA library using a yeast two-hybrid system.
12200134 2002 Processing of native caspase-14 occurs at an atypical cleavage site in normal epidermal differentiation.
12150984 2002 Calpain II colocalizes with detergent-insoluble rafts on human and Jurkat T-cells.
12121992 2002 SNAP-23 is a target for calpain cleavage in activated platelets.
12000759 2002 Ionomycin-activated calpain triggers apoptosis. A probable role for Bcl-2 family members.
11861304 2002 Calpain is a signal transducer and activator of transcription (STAT) 3 and STAT5 protease.
11516996 2001 The calpain family and human disease.
10846184 2000 Src-mediated tyrosine phosphorylation of NR2 subunits of N-methyl-D-aspartate receptors protects from calpain-mediated truncation of their C-terminal domains.
10830966 2000 Neurotoxicity induces cleavage of p35 to p25 by calpain.
10677567 2000 Molecular interactions between presenilin and calpain: inhibition of m-calpain protease activity by presenilin-1, 2 and cleavage of presenilin-1 by m-, mu-calpain.
10521480 1999 The PEST domain of IkappaBalpha is necessary and sufficient for in vitro degradation by mu-calpain.
9989581 1999 Calpain-induced proteolysis of beta-spectrins.
9852298 1998 The presenilin 2 loop domain interacts with the mu-calpain C-terminal region.
9407132 1997 Calcium-dependent signaling pathways in T cells. Potential role of calpain, protein tyrosine phosphatase 1b, and p130Cas in integrin-mediated signaling events.
9271093 1997 Calcium-binding properties of human erythrocyte calpain.
9110986 1997 Inositol polyphosphate 4-phosphatase is inactivated by calpain-mediated proteolysis in stimulated human platelets.
8993318 1997 Site-directed mutagenesis of alpha II spectrin at codon 1175 modulates its mu-calpain susceptibility.
8954105 1996 Modulation of the calpain autoproteolysis by calpastatin and phospholipids.
8938448 1996 Definition of the minimal MEN1 candidate area based on a 5-Mb integrated map of proximal 11q13. The European Consortium on Men1, (GENEM 1; Groupe d'Etude des Néoplasies Endocriniennes Multiples de type 1).
8769305 1996 Autolysis of human erythrocyte calpain produces two active enzyme forms with different cell localization.
8702541 1996 The major calpain isozymes are long-lived proteins. Design of an antisense strategy for calpain depletion in cultured cells.
8695851 1996 p120c-cbl is present in human blood platelets and is differentially involved in signaling by thrombopoietin and thrombin.
8561910 1995 Calpain: novel family members, activation, and physiologic function.
8253784 1993 Contiguous binding and inhibitory sites on kininogens required for the inhibition of platelet calpain.
7592818 1995 Calpain cleavage of the cytoplasmic domain of the integrin beta 3 subunit.
7499244 1995 Differential sensitivity of interleukin-1 alpha and -beta precursor proteins to cleavage by calpain, a calcium-dependent protease.
7493986 1995 Primary structure of a gamma subunit of G protein, gamma 12, and its phosphorylation by protein kinase C.
3038169 1987 Interaction of human calpains I and II with high molecular weight and low molecular weight kininogens and their heavy chain: mechanism of interaction and the role of divalent cations.
3017764 1986 Complete amino acid sequence of the large subunit of the low-Ca2+-requiring form of human Ca2+-activated neutral protease (muCANP) deduced from its cDNA sequence.
2844821 1988 The calmodulin-binding site in alpha-fodrin is near the calcium-dependent protease-I cleavage site.
2400579 1990 A novel member of the calcium-dependent cysteine protease family.
2209092 1990 Four genes for the calpain family locate on four distinct human chromosomes.
1656060 1991 Calcium-activated neutral proteinase (CANP; calpain) activity in Schwann cells: immunofluorescence localization and compartmentation of mu- and mCANP.