Property Summary

NCBI Gene PubMed Count 43
PubMed Score 22.37
PubTator Score 80.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -2.600 1.2e-07
glioblastoma 2.600 2.5e-03
osteosarcoma -1.360 2.8e-02
cystic fibrosis 1.127 3.1e-05
tuberculosis 1.300 6.5e-07
primary pancreatic ductal adenocarcinoma 2.190 3.1e-03
intraductal papillary-mucinous adenoma (... 1.800 3.3e-03
intraductal papillary-mucinous carcinoma... 1.100 4.9e-02
lung cancer -1.200 8.2e-03
pancreatic cancer 2.300 4.5e-03
breast carcinoma 1.200 7.3e-05
interstitial cystitis -1.800 7.8e-05
pediatric high grade glioma 1.900 3.9e-05
pilocytic astrocytoma 1.200 3.2e-05
subependymal giant cell astrocytoma 2.357 2.1e-02
invasive ductal carcinoma 1.962 1.7e-05
lung carcinoma -2.300 4.8e-23
ductal carcinoma in situ 1.300 1.9e-04
ovarian cancer 2.100 4.0e-04

Gene RIF (25)

PMID Text
26757732 The composite biomarker, CAPG and GIPC1 in primary breast tumors, predicted disease outcomes and benefit from zoledronate and may facilitate patient selection for adjuvant bisphosphonate treatment.
26466680 On the basis of these results, we propose a model in which dynamic vimentin filaments target CARMIL2 to critical membrane-associated locations, where CARMIL2 regulates CP, and thus actin assembly, to create cell protrusions
24804218 A single nucleotide polymorphism rs6886 inside the CapG gene was identified, affecting a CapG phosphorylation site and thus potentially modifying CapG function.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of capping protein gelsolin-like (CAPG) expression by HIV-1 Vpr in Vpr transduced macrophages
23782053 CapG was up-regulated in the tumor tissues of patients with lymph node metastasis (LNM), whereas it showed an equivalent expression level between non-tumor and tumor tissues of patients without LNM.
23085225 CapG is involved in the process of metastasis by promoting the invasiveness of tumor cells.
22190510 Expression of CapG, gelsolin, and P-gp was found to be associated with an increased risk of death from non-small cell lung cancer.
22155129 CapG was identified as a novel candidate biomarker to predict response to gemcitabine treatment and survival in cholangiocarcinoma.
21908955 These results suggest that overexpression of CapG may be associated with progression of lung adenocarcinoma.
21768101 strong down-regulation of MCK activity contributes to F-actin instability and induces post-translational modification of alphaB-crystallin and desmin
19454010 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of capping protein gelsolin-like (CAPG) expression by HIV-1 Vpr in Vpr transduced macrophages
19439302 Proteomic study of macrophages exposed to oxLDL identifies a CAPG polymorphism associated with carotid atherosclerosis.
19242827 CapG was upregulated in the stroma cells of nasopharyngeal carcinoma (NPC) compared with normal nasopharyngeal epithelial tissues. CapG possibly plays a role in the complex interaction between NPC cells and the surrounding host tissue.
19188659 Hypoxia-inducible factor 1alpha up-regulated CapG protein expression under normoxia. Knockdown of HIF-1alpha expression in hPASMCs also inhibited hypoxia-induced CapG up-regulation.
19166812 A role for the actin-binding protein CapG as a mediator of cross-talk between the actin cytoskeleton and microtubule-based organelles that regulate cell division was proposed.
19011242 several genes that are known to be regulated by DNA methylation were up-regulated dramatically by integrin alpha6beta4 expression, including S100A4, FST, PDLIM4, CAPG, and Nkx2.2.
18938132 These results suggest that filamentous actin in the nucleolus might be regulated by actin binding proteins such as CapG.
18709641 the 4 biomarkers CLU, ITGB3, PRAME and CAPG may be used as prognostic factors for patients with stage III serous ovarian adenocarcinomas.
18461482 CapG mobility in cell nuclei of live breast cancer cells
18266911 Results report that NTF2 and Ran control nuclear import of the filamentous actin capping protein CapG.
18237446 Dysregulated expression of gelsolin-like actin capping protein(CapG) was found in premalignant and malignant oral carcinogenesis.
18059028 Comprehension of the mobility and compartmentalization of the CapG protein in normal and in cancer cells in vivo could constitute a new basis to characterize the invasiveness and metastasizing potential of breast cancer.
16767159 CapG is a new tumor suppressor gene involved in the tumorigenic progression of certain cancers
15454578 importin-beta-dependent nuclear import of the actin modulating protein CapG promotes cell invasion
12637565 CapG lacks a nuclear export sequence present in structurally related proteins

AA Sequence

MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSHLHLWIGQQSS      1 - 70
RDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGGVESAFHKTSTGAPAAIKKLY     71 - 140
QVKGKKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGGKSNILERNKARDLALAIRDSERQGKAQVEI    141 - 210
VTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKANAQAAALYKVSDATGQMNLTKVADSSPFALELLISD    211 - 280
DCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGHESPIFKQFFKDWK      281 - 348
//

Text Mined References (49)

PMID Year Title
26757732 2016 CAPG and GIPC1: Breast Cancer Biomarkers for Bone Metastasis Development and Treatment.
26634544 2015 Influence of suppression of CapG gene expression by siRNA on the growth and metastasis of human prostate cancer cells.
26466680 2015 CARMIL2 is a novel molecular connection between vimentin and actin essential for cell migration and invadopodia formation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24804218 2014 Macrophage capping protein CapG is a putative oncogene involved in migration and invasiveness in ovarian carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24236012 2013 L-plastin nanobodies perturb matrix degradation, podosome formation, stability and lifetime in THP-1 macrophages.
23782053 2013 Laser microdissection and two-dimensional difference gel electrophoresis reveal the role of a novel macrophage-capping protein in lymph node metastasis in gastric cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23085225 2013 Proteomic identification of the macrophage-capping protein as a protein contributing to the malignant features of hepatocellular carcinoma.
22190510 2012 Prognostic evaluation of CapG, gelsolin, P-gp, GSTP1, and Topo-II proteins in non-small cell lung cancer.
22155129 2012 Macrophage-capping protein as a tissue biomarker for prediction of response to gemcitabine treatment and prognosis in cholangiocarcinoma.
21908955 2011 Overexpression of gelsolin-like actin-capping protein is associated with progression of lung adenocarcinoma.
21768101 2011 Muscle creatine kinase deficiency triggers both actin depolymerization and desmin disorganization by advanced glycation end products in dilated cardiomyopathy.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19439302 2009 Proteomic study of macrophages exposed to oxLDL identifies a CAPG polymorphism associated with carotid atherosclerosis.
19242827 2010 Proteomic analysis of the stroma-related proteins in nasopharyngeal carcinoma and normal nasopharyngeal epithelial tissues.
19188659 2009 Up-regulation of two actin-associated proteins prompts pulmonary artery smooth muscle cell migration under hypoxia.
19166812 2009 The actin-capping protein CapG localizes to microtubule-dependent organelles during the cell cycle.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19011242 2009 Integrin alpha6beta4 controls the expression of genes associated with cell motility, invasion, and metastasis, including S100A4/metastasin.
18938132 2008 The F-actin filament capping protein CapG is a bona fide nucleolar protein.
18709641 2008 Four potential biomarkers as prognostic factors in stage III serous ovarian adenocarcinomas.
18461482 2008 Dynamics of the CapG actin-binding protein in the cell nucleus studied by FRAP and FCS.
18266911 2008 A new role for nuclear transport factor 2 and Ran: nuclear import of CapG.
18237446 2008 Clinical significance of gelsolin-like actin-capping protein expression in oral carcinogenesis: an immunohistochemical study of premalignant and malignant lesions of the oral cavity.
18059028 2008 Invasive breast cancer cells exhibit increased mobility of the actin-binding protein CapG.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16767159 2006 Suppression of tumorigenicity, but not anchorage independence, of human cancer cells by new candidate tumor suppressor gene CapG.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454578 2004 Increased importin-beta-dependent nuclear import of the actin modulating protein CapG promotes cell invasion.
12754261 2003 Cap G, a gelsolin family protein modulating protective effects of unidirectional shear stress.
12637565 2003 The Nucleo-cytoplasmic actin-binding protein CapG lacks a nuclear export sequence present in structurally related proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11694586 2001 Cell cycle-dependent expression and nucleolar localization of hCAP-H.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
9160743 1997 Condensins, chromosome condensation protein complexes containing XCAP-C, XCAP-E and a Xenopus homolog of the Drosophila Barren protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7851883 1994 The human actin-regulatory protein cap G: gene structure and chromosome location.
7814409 1995 Gain-of-function mutations conferring actin-severing activity to human macrophage cap G.
1322908 1992 Molecular cloning of human macrophage capping protein cDNA. A unique member of the gelsolin/villin family expressed primarily in macrophages.