Property Summary

NCBI Gene PubMed Count 37
PubMed Score 7.62
PubTator Score 117.26

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (10)

Gene RIF (17)

PMID Text
25652936 a high expression of CAP1 is involved in the pathogenesis of EOC, and that the downregulation of CAP1 in tumor cells may be a therapeutic target for the treatment of patients with EOC.
25371324 CAP1 is involved in the brain metastasis in non-small cell lung cancer.CAP1 overexpression is associated with poor prognosis in non-small cell lung cancer patients.
25332229 This study demonstrated an inverse relationship between CAP1 and MMP-9 expression, high expression of MMP-9 and low expression of CAP1 in those with chronic obstructive pulmonary disease compared with the non-chronic obstructive pulmonary disease group.
24606903 Overexpression of CAP1 in monocytes enhanced the resistin-induced increased activity of the cAMP-dependent signaling.
24522810 Overexpression of CAP1 is associated with breast carcinoma.
24509166 CAP1 might be a potential molecular targeted therapy for surgery and immune treatment.
24359721 results indicate that upregulated expression of CAP1 might contribute heavily to the metastasis of hepatocellular carcinoma.
23904342 Findings suggest that CAP1 (cyclase-associated protein 1) is involved in the metastasis of esophageal squamous cell carcinoma, and increased expression may indicate a poor prognosis.
23842884 overexpression of CAP1 in lung cancer cells, particularly at the metastatic stage, may have significant clinical implications as a diagnostic/prognostic factor for lung cancer.
23737525 CAP1 depletion also led to changes in cofilin phosphorylation and localization as well as activation of focal adhesion kinase (FAK) and enhanced cell spreading.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19188911 The overexpression of CAP1 in pancreatic cancers is demonstrated and the involvement of CAP1 in the aggressive behavior of pancreatic cancer cells is suggested.
18716285 These studies suggest that CAP1 provides a direct link from the actin cytoskeleton to the mitochondria by functioning as an actin shuttle.
18671965 The high turnover rate of CAP1 by MMP-9, comparable to that of gelatin as the natural extracellular substrate of this enzyme, may be critical to prevent pathological conditions associated with considerable cytolysis.
17900295 Based on an analysis of 1075 beta-thalassemia alleles the CAP+1 (A-->C) mutation constituted 3.2% of north Indians.
11950878 plays a key role in speeding up the turnover of actin filaments by effectively recycling cofilin and actin and through its effect on both ends of actin filament

AA Sequence

MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQ      1 - 70
KHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQA     71 - 140
LGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKT    141 - 210
GPVAKELSGLPSGPSAGSCPPPPPPCPPPPPVSTISCSYESASRSSLFAQINQGESITHALKHVSDDMKT    211 - 280
HKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQV    281 - 350
AYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYL    351 - 420
SKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG                   421 - 475
//

Text Mined References (54)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25652936 2015 CAP1 is overexpressed in human epithelial ovarian cancer and promotes cell proliferation.
25371324 2015 Overexpression of adenylate cyclase-associated protein 1 may predict brain metastasis in non-small cell lung cancer.
25332229 2014 Relationship between expression of matrix metalloproteinase-9 and adenylyl cyclase-associated protein 1 in chronic obstructive pulmonary disease.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24606903 2014 Adenylyl cyclase-associated protein 1 is a receptor for human resistin and mediates inflammatory actions of human monocytes.
24522810 2014 High expression and prognostic role of CAP1 and CtBP2 in breast carcinoma: associated with E-cadherin and cell proliferation.
24509166 2014 Knocking down the expression of adenylate cyclase-associated protein 1 inhibits the proliferation and migration of breast cancer cells.
24359721 2014 Upregulated expression of CAP1 is associated with tumor migration and metastasis in hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23904342 2013 Downregulated expression of the cyclase-associated protein 1 (CAP1) reduces migration in esophageal squamous cell carcinoma.
23842884 2013 Overexpression of adenylate cyclase-associated protein 1 is associated with metastasis of lung cancer.
23737525 2013 Mammalian adenylyl cyclase-associated protein 1 (CAP1) regulates cofilin function, the actin cytoskeleton, and cell adhesion.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19188911 2009 Adenylate cyclase-associated protein 1 overexpressed in pancreatic cancers is involved in cancer cell motility.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18716285 2008 Mitochondrial shuttling of CAP1 promotes actin- and cofilin-dependent apoptosis.
18671965 2008 Adenylyl cyclase-associated protein-1/CAP1 as a biological target substrate of gelatinase B/MMP-9.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
17900295 2007 The clinical significance of the spectrum of interactions of CAP+1 (A-->C), a silent beta-globin gene mutation, with other beta-thalassemia mutations and globin gene modifiers in north Indians.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16807684 2006 Phosphoproteomic analysis of the human pituitary.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15311924 2004 Crystal structure of the actin binding domain of the cyclase-associated protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11950878 2002 Human CAP1 is a key factor in the recycling of cofilin and actin for rapid actin turnover.
8761950 1996 Mammalian CAP interacts with CAP, CAP2, and actin.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7962207 1994 Comparison of human CAP and CAP2, homologs of the yeast adenylyl cyclase-associated proteins.
1406678 1992 Identification of a human cDNA encoding a protein that is structurally and functionally related to the yeast adenylyl cyclase-associated CAP proteins.