Property Summary

NCBI Gene PubMed Count 38
PubMed Score 29.73
PubTator Score 36.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 1.0
Disease Target Count Z-score Confidence
Intellectual disability 573 0.0 4.0

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma 5.900 3.9e-10
astrocytic glioma -2.300 4.0e-03
ependymoma -3.300 4.0e-15
oligodendroglioma -2.200 1.3e-02
psoriasis -1.900 5.9e-04
glioblastoma -3.500 3.0e-05
osteosarcoma 1.322 1.1e-04
medulloblastoma -1.500 2.2e-05
cystic fibrosis -2.218 1.3e-06
atypical teratoid / rhabdoid tumor -3.600 7.1e-06
medulloblastoma, large-cell -3.400 6.7e-06
primitive neuroectodermal tumor -1.400 8.9e-03
pancreatic ductal adenocarcinoma liver m... -1.037 3.8e-02
tuberculosis and treatment for 3 months 1.100 1.5e-03
non-small cell lung cancer -1.370 1.6e-10
intraductal papillary-mucinous adenoma (... 2.500 4.9e-04
lung cancer -1.200 4.4e-02
Breast cancer 3.000 2.5e-02
adult high grade glioma -3.200 7.1e-09
pilocytic astrocytoma -2.100 4.8e-09
Pick disease 1.100 2.9e-03
ovarian cancer 2.700 1.1e-06

Gene RIF (26)

PMID Text
26414223 Nuclear expression of CAMTA1 can be used in the differential diagnosis of epithelioid hemangioendotheliomas.
25961935 Our findings elucidate the mechanistic basis of the oncogenic properties of TAZ-CAMTA1 fusion
25879300 Nuclear CAMTA1 expression is sensitive and highly specific for epithelioid haemangioendothelioma and can be applied to diagnostic immunohistochemistry in epithelioid tumours.
25817592 we demonstrate additional structural complexity in WWTR1-CAMTA1 fusion transcripts in epithelioid haemangioendothelioma
25353289 Report CAMTA1-WWTR1 gene fusion in thoracic epithelioid hemangioendothelioma but not epithelioid angiosarcoma.
25110239 Epithelioid hemangioendothelioma, it's potential mimickers, and other benign or malignant vascular tumors showed strong and diffuse CAMTA1 expression, nullifying it's potential use as an adjunct in the differential diagnosis.
24738973 Intragenic CAMTA1 deletions are associated with a spectrum of neurobehavioral phenotypes
22715383 Cell-cell communications between the stem cells and adjacent cardiomyocytes induce Ca(2+) signals that activate a myocardial gene program in the stem cells via a novel and early Ca(2+)-dependent intermediate, up-regulation of CAMTA1.
22693284 The authors present evidence that loss-of-function of CAMTA1, a brain-specific calcium responsive transcription factor, is responsible for NPCA with or without ID.
22429593 Using reverse transcription-polymerase chain reaction (RT-PCR) and subsequent sequencing, we confirmed an identical WWTR1-CAMTA1 fusion transcript product from different nodules in each patient.
21951953 Results indicate that CAMTA1 genotype is associated with cognitive function in older adults with cardiovascular disease, because carriers of the T allele performed more poorly on tests of attention, executive function, and psychomotor speed.
21857646 CAMTA1 was identified as an miR-9/9* and miR- 17 target. CAMTA1 expression led to reduced neurosphere formation and growth of human glioblastomas in nude mice. Consistently, CAMTA1 and NPPA expression correlate with patient survival.
21584898 the presence of a WWTR1-CAMTA1 fusion in all EHE tested from bone, soft tissue, and visceral location
21385898 Findings define properties of CAMTA1 in growth suppression and neuronal differentiation that support its assignment as a 1p36 tumor suppressor gene in neuroblastoma.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
20125193 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
18210030 Observational study of gene-disease association. (HuGE Navigator)
17470457 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17470457 validated genomic and functional biological findings described herein suggest a role for CAMTA1 in human episodic memory.
17222547 no evidence for somatic mutations in FLJ10737 in neuroblastoma
12964007 FLJ10737 and CAMTA1 genes on 1p36.31-p36.23 are candidate tumor suppressor genes of neuroblastoma

AA Sequence

MWRAEGKWLPKTSRKSVSQSVFCGTSTYCVLNTVPPIEDDHGNSNSSHVKIFLPKKLLECLPKCSSLPKE      1 - 70
RHRWNTNEEIAAYLITFEKHEEWLTTSPKTRPQNGSMILYNRKKVKYRKDGYCWKKRKDGKTTREDHMKL     71 - 140
KVQGVECLYGCYVHSSIIPTFHRRCYWLLQNPDIVLVHYLNVPAIEDCGKPCGPILCSINTDKKEWAKWT    141 - 210
KEELIGQLKPMFHGIKWTCSNGNSSSGFSVEQLVQQILDSHQTKPQPRTHNCLCTGSLGAGGSVHHKCNS    211 - 280
AKHRIISPKVEPRTGGYGSHSEVQHNDVSEGKHEHSHSKGSSREKRNGKVAKPVLLHQSSTEVSSTNQVE    281 - 350
VPDTTQSSPVSISSGLNSDPDMVDSPVVTGVSGMAVASVMGSLSQSATVFMSEVTNEAVYTMSPTAGPNH    351 - 420
HLLSPDASQGLVLAVSSDGHKFAFPTTGSSESLSMLPTNVSEELVLSTTLDGGRKIPETTMNFDPDCFLN    421 - 490
NPKQGQTYGGGGLKAEMVSSNIRHSPPGERSFSFTTVLTKEIKTEDTSFEQQMAKEAYSSSAAAVAASSL    491 - 560
TLTAGSSLLPSGGGLSPSTTLEQMDFSAIDSNKDYTSSFSQTGHSPHIHQTPSPSFFLQDASKPLPVEQN    561 - 630
THSSLSDSGGTFVMPTVKTEASSQTSSCSGHVETRIESTSSLHLMQFQANFQAMTAEGEVTMETSQAAEG    631 - 700
SEVLLKSGELQACSSEHYLQPETNGVIRSAGGVPILPGNVVQGLYPVAQPSLGNASNMELSLDHFDISFS    701 - 770
NQFSDLINDFISVEGGSSTIYGHQLVSGDSTALSQSEDGARAPFTQAEMCLPCCSPQQGSLQLSSSEGGA    771 - 840
STMAYMHVAEVVSAASAQGTLGMLQQSGRVFMVTDYSPEWSYPEGGVKVLITGPWQEASNNYSCLFDQIS    841 - 910
VPASLIQPGVLRCYCPAHDTGLVTLQVAFNNQIISNSVVFEYKARALPTLPSSQHDWLSLDDNQFRMSIL    911 - 980
ERLEQMERRMAEMTGSQQHKQASGGGSSGGGSGSGNGGSQAQCASGTGALGSCFESRVVVVCEKMMSRAC    981 - 1050
WAKSKHLIHSKTFRGMTLLHLAAAQGYATLIQTLIKWRTKHADSIDLELEVDPLNVDHFSCTPLMWACAL   1051 - 1120
GHLEAAVVLYKWDRRAISIPDSLGRLPLGIARSRGHVKLAECLEHLQRDEQAQLGQNPRIHCPASEEPST   1121 - 1190
ESWMAQWHSEAISSPEIPKGVTVIASTNPELRRPRSEPSNYYSSESHKDYPAPKKHKLNPEYFQTRQEKL   1191 - 1260
LPTALSLEEPNIRKQSPSSKQSVPETLSPSEGVRDFSRELSPPTPETAAFQASGSQPVGKWNSKDLYIGV   1261 - 1330
STVQVTGNPKGTSVGKEAAPSQVRPREPMSVLMMANREVVNTELGSYRDSAENEECGQPMDDIQVNMMTL   1331 - 1400
AEHIIEATPDRIKQENFVPMESSGLERTDPATISSTMSWLASYLADADCLPSAAQIRSAYNEPLTPSSNT   1401 - 1470
SLSPVGSPVSEIAFEKPNLPSAADWSEFLSASTSEKVENEFAQLTLSDHEQRELYEAARLVQTAFRKYKG   1471 - 1540
RPLREQQEVAAAVIQRCYRKYKQYALYKKMTQAAILIQSKFRSYYEQKKFQQSRRAAVLIQKYYRSYKKC   1541 - 1610
GKRRQARRTAVIVQQKLRSSLLTKKQDQAARKIMRFLRRCRHSPLVDHRLYKRSERIEKGQGT          1611 - 1673
//

Text Mined References (39)

PMID Year Title
26414223 2016 Nuclear Expression of CAMTA1 Distinguishes Epithelioid Hemangioendothelioma From Histologic Mimics.
25961935 2016 Mechanism of action of a WWTR1(TAZ)-CAMTA1 fusion oncoprotein.
25879300 2015 CAMTA1 is a useful immunohistochemical marker for diagnosing epithelioid haemangioendothelioma.
25817592 2015 Molecular characterization of epithelioid haemangioendotheliomas identifies novel WWTR1-CAMTA1 fusion variants.
25353289 2015 Thoracic epithelioid malignant vascular tumors: a clinicopathologic study of 52 cases with emphasis on pathologic grading and molecular studies of WWTR1-CAMTA1 fusions.
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
25110239 2014 CAMTA1 immunostaining is not useful in differentiating epithelioid hemangioendothelioma from its potential mimickers.
24770850 2014 Genome-wide association study of sexual maturation in males and females highlights a role for body mass and menarche loci in male puberty.
24738973 2015 Intragenic CAMTA1 deletions are associated with a spectrum of neurobehavioral phenotypes.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
22715383 2012 Calcium dependent CAMTA1 in adult stem cell commitment to a myocardial lineage.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
22693284 2012 Intragenic CAMTA1 rearrangements cause non-progressive congenital ataxia with or without intellectual disability.
22429593 Monoclonality of multifocal epithelioid hemangioendothelioma of the liver by analysis of WWTR1-CAMTA1 breakpoints.
21951953 2011 CAMTA1 T polymorphism is associated with neuropsychological test performance in older adults with cardiovascular disease.
21857646 2011 CAMTA1 is a novel tumour suppressor regulated by miR-9/9* in glioblastoma stem cells.
21584898 2011 A novel WWTR1-CAMTA1 gene fusion is a consistent abnormality in epithelioid hemangioendothelioma of different anatomic sites.
21385898 2011 CAMTA1, a 1p36 tumor suppressor candidate, inhibits growth and activates differentiation programs in neuroblastoma cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
18210030 2008 Analysis of novel risk loci for type 2 diabetes in a general French population: the D.E.S.I.R. study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17470457 2007 Calmodulin-binding transcription activator 1 (CAMTA1) alleles predispose human episodic memory performance.
17222547 2007 Allelic variants of CAMTA1 and FLJ10737 within a commonly deleted region at 1p36 in neuroblastoma.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15709179 2005 Allelic losses at 1p36 and 19q13 in gliomas: correlation with histologic classification, definition of a 150-kb minimal deleted region on 1p36, and evaluation of CAMTA1 as a candidate tumor suppressor gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15138581 2004 Cell cycle-dependent transcriptional regulation of calmodulin-binding transcription activator 1 in neuroblastoma cells.
12964007 2003 Identification and characterization of FLJ10737 and CAMTA1 genes on the commonly deleted region of neuroblastoma at human chromosome 1p36.31-p36.23.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11925432 2002 A novel family of calmodulin-binding transcription activators in multicellular organisms.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.