Property Summary

NCBI Gene PubMed Count 26
PubMed Score 74.66
PubTator Score 39.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 2.093 1.5e-04
ovarian cancer -1.600 1.8e-06

Gene RIF (12)

PMID Text
23879967 A novel interaction between calcium-modulating cyclophilin ligand and Basigin regulates calcium signaling and matrix metalloproteinase activities in human melanoma cells.
23266901 Found that the calcium-modulating cyclophilin ligand (CAMLG), which is involved in Ca(2+) signaling, was the major host cell PilA binding protein.
23041287 Results indicate calcium-modulating cyclophilin ligand (CAML) and WRB as components of the TRC40 receptor complex and a crucial mechanism for driving ER membrane insertion of TA proteins in mammalian cells.
22281498 this study demonstrated that DENV manipulated the levels of CAML to subvert the apoptotic process which in turn favoured efficient virus production.
21128111 CAML was found to play a crucial role in the PRL/PRLR-dependent growth of breast cancer cells.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20126395 Data show that tetherin restricts particle release and does not require CAML for this effect.
19135167 Binding of the MUC1 CT to CAML in human epithelial cells was confirmed by reciprocal coimmunoprecipitations, confocal microscopy, protein crosslinking, and coupled transcription/translation analyses.
16243292 The intracellular C-terminus of fibrocystin interacts with CAML, a protein with an intracellular distribution that is similar to that of PKD2.
15668245 CAML is an important signal transducer for the actions of Ang II in regulating the calcineurin-NFAT pathway and the interaction of CAML with ATRAP may mediate the Ang II actions in vascular physiology
12388711 Kaposi's sarcoma-associated herpesvirus mitochondrial K7 protein targets cellular CAML to increase the cytosolic Ca(2+) response, which consequently protects cells from mitochondrial damage and apoptosis
12031912 CAMLG was more frequently significantly overexpressed in acute myeloid leukemia patients with CD56 immunophenoytpe

AA Sequence

MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDS      1 - 70
DKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLT     71 - 140
ADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKY    141 - 210
LSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFT    211 - 280
FIFCHELLDYWGSEVP                                                          281 - 296
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24392163 2014 WRB and CAML are necessary and sufficient to mediate tail-anchored protein targeting to the ER membrane.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23879967 2013 A novel interaction between calcium-modulating cyclophilin ligand and Basigin regulates calcium signaling and matrix metalloproteinase activities in human melanoma cells.
23266901 2013 Type IV pilus protein PilA of Pseudomonas aeruginosa modulates calcium signaling through binding the calcium-modulating cyclophilin ligand.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23041287 2012 Molecular machinery for insertion of tail-anchored membrane proteins into the endoplasmic reticulum membrane in mammalian cells.
22281498 2012 Dengue virus utilizes calcium modulating cyclophilin-binding ligand to subvert apoptosis.
21269460 2011 Initial characterization of the human central proteome.
21128111 2011 CAML promotes prolactin-dependent proliferation of breast cancer cells by facilitating prolactin receptor signaling pathways.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20126395 2010 CAML does not modulate tetherin-mediated restriction of HIV-1 particle release.
19946888 2010 Defining the membrane proteome of NK cells.
19135167 2009 MUC1 mucin interacts with calcium-modulating cyclophilin ligand.
18391951 2008 Many sequence variants affecting diversity of adult human height.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16243292 2005 Fibrocystin interacts with CAML, a protein involved in Ca2+ signaling.
15668245 2005 Identification of calcium-modulating cyclophilin ligand (CAML) as transducer of angiotensin II-mediated nuclear factor of activated T cells (NFAT) activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451437 2004 Immediate early gene X-1 interacts with proteins that modulate apoptosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12919676 2003 CAML is required for efficient EGF receptor recycling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388711 2002 Kaposi's sarcoma-associated herpesvirus mitochondrial K7 protein targets a cellular calcium-modulating cyclophilin ligand to modulate intracellular calcium concentration and inhibit apoptosis.
12031912 2002 Overexpression of translocation-associated fusion genes of FGFRI, MYC, NPMI, and DEK, but absence of the translocations in acute myeloid leukemia. A microarray analysis.
11006089 2000 Calcium-modulating cyclophilin ligand desensitizes hormone-evoked calcium release.
9632697 1998 Co-localization of calcium-modulating cyclophilin ligand with intracellular calcium pools.
9311921 1997 NF-AT activation induced by a CAML-interacting member of the tumor necrosis factor receptor superfamily.
8824814 1996 The gene for calcium-modulating cyclophilin ligand (CAMLG) is located on human chromosome 5q23 and a syntenic region of mouse chromosome 13.
7522304 1994 Calcium signalling in T cells stimulated by a cyclophilin B-binding protein.