Property Summary

NCBI Gene PubMed Count 43
PubMed Score 116.76
PubTator Score 80.58

Knowledge Summary

Patent (3,875)

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma -1.400 6.4e-17
ependymoma -2.600 1.7e-17
oligodendroglioma -1.400 2.5e-11
psoriasis 3.000 1.9e-05
glioblastoma -2.600 7.0e-10
osteosarcoma -3.001 1.5e-08
medulloblastoma -1.900 1.1e-08
cystic fibrosis 1.054 3.8e-04
atypical teratoid / rhabdoid tumor -2.500 3.2e-13
medulloblastoma, large-cell -1.500 8.4e-05
primitive neuroectodermal tumor -2.100 1.6e-05
pancreatic ductal adenocarcinoma liver m... 1.494 5.6e-03
adult high grade glioma -2.500 2.0e-04
pilocytic astrocytoma -2.300 4.5e-07
aldosterone-producing adenoma -1.119 2.1e-02
subependymal giant cell astrocytoma -3.318 1.0e-03
Pick disease -1.600 1.1e-03
ovarian cancer 1.700 1.5e-06

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (35)

PMID Text
27151216 Site-directed mutagenesis analysis revealed that Leu(358) in CaMKKbeta/Ile(322) in CaMKKalpha confer, at least in part, a distinct recognition of AMPK but not of CaMKIalpha.
26824050 Clopidogrel diminishes TNFalpha-stimulated VCAM-1 expression at least in part via HO-1 induction and CaMKKbeta/AMPK/Nrf2 pathway in endothelial cells.
26552607 CaMKK2 (and Nup62) are required for optimal androgen receptor transcriptional activity in castrate resistant prostate cancer cells.
25847065 CAMKK2 protein is highly up regulated in hepatocellular carcinoma.
25756516 Silencing of CAMKK2 using siRNA significantly reduced cell proliferation, colony formation and invasion of gastric cancer cells.
25679868 CaMKK2 plays a pivotal role in the calcium signaling cascade regulating adrenal aldosterone production.
25590814 CaMKKbeta-AMPKalpha2 signaling contributes to mitotic Golgi fragmentation and the G2/M transition in mammalian cells.
25394900 PCa patients with miR-224-low/CAMKK2-high expression more frequently had shorter overall survival.
23958956 evidence supports that CAMKK2 is a novel schizophrenia susceptibility gene.
23754392 Pulsatile shear stress mimicking atheroprotective flow increases the level of sirtuin (SIRT)1 in cultured endothelial cells by enhancing its stability, an effect abolished by inhibition or knockdown of CaMKKbeta.
23465592 CaMKIIalpha phosphorylation was enhanced by S-Allyl cysteine treatment in a concentration- and time-dependent manner, which paralleled AMPK activation.
23110126 CaMKKbeta is involved in AMP-activated protein kinase activation by baicalin in LKB1 deficient cell lines.
23027865 amino acid starvation regulates autophagy in part through an increase in cellular Ca(2+) that activates a CaMKK-beta-AMPK pathway and inhibits mTORC1, which results in ULK1 stimulation
22778263 Calcium/calmodulin-dependent protein kinase kinase 2 has roles in signaling and pathophysiology [review]
22654108 Results suggest that in PCa progression, CaMKK2 and the AR are in a feedback loop in which CaMKK2 is induced by the AR to maintain AR activity, AR-dependent cell cycle control, and continued cell proliferation.
21957496 Data show that protein kinase A (PKA) regulates the alternative splicing of Ca(2)/calmodulin-dependent protein kinase kinase 2 (CaMKK2) to produce variants that differentially modulate neuronal differentiation.
21807092 Our results demonstrate that CaMKKbeta and AMP-activated protein kinase form a unique signaling complex
21670147 Findings reveal that hypoxia can trigger AMPK activation in the apparent absence of increased [AMP] through ROS-dependent CRAC channel activation, leading to increases in cytosolic calcium that activate the AMPK upstream kinase CaMKKbeta.
21669867 phosphorylation of CaMKKbeta regulates its half-life.
21084482 These results suggest that CaMKK is an important factor for human cytomegalovirus replication and human cytomegalovirus-mediated glycolytic activation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20018878 CaMKK is involved in both S1P receptor- and SR-BI-mediated phosphorylation of AMPK, Akt, and eNOS.
19958286 Calmodulin-dependent protein kinase kinase-beta activates AMPK without forming a stable complex. There is a synergistic effects of Ca2+ and AMP.
19763792 ERK activation and cell growth require CaM kinases in MCF-7 breast cancer cells
19667195 Data show that that the prototypical CaM target sequence skMLCK, a fragment from skeletal muscle myosin light chain kinase, binds to CaM in a highly cooperative way, while only a lower degree of interdomain binding cooperativity emerges for CaMKK.
19407487 Growth of cervical cancer cells was inhibited through activation of CAMKK2 and LBK1.
18976975 Knockdown of calcium/calmodulin-dependent protein kinase kinase 2 beta (CAMKK2) by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18436530 modulating basal AMPK and CAMKKB activity in the hypothalamus is essential for maintaining tight regulation of pathways contributing to food intake
17197037 Observational study of gene-disease association. (HuGE Navigator)
17197037 a prominent association found between severity of panic- and agoraphobia symptoms and an exonic SNP (rs3817190) in the CaMKKb gene and a trend for association with an exonic SNP in P2RX7 (rs1718119) with severity scores in the panic- and agoraphobia scale
16880506 Endothelial cells possess two pathways to activate AMPK, one Ca2+/CaMKKbeta dependent and one AMP/LKB1 dependent.
16673375 Observational study of gene-disease association. (HuGE Navigator)
16054096 Overexpression of CaMKKbeta in mammalian cells increases AMPK activity, whereas pharmacological inhibition of CaMKK, or downregulation of CaMKKbeta using RNA interference, almost completely abolishes AMPK activation
16054095 There is a significant basal activity and phosphorylation of AMPK in LKB1-deficient cells that can be stimulated by Ca2+ ionophores, and studies using the CaMKK inhibitor STO-609 and isoform-specific siRNAs show that CaMKKbeta is required for this effect

AA Sequence

MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLAR      1 - 70
DRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRL     71 - 140
PRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRR    141 - 210
PPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPT    211 - 280
LKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGT    281 - 350
PAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK    351 - 420
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVILVKTM    421 - 490
IRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQPPGHRPAPRGGGGSALVRGSP    491 - 560
CVESCWAPAPGSPARMHPLRPEEAMEPE                                              561 - 588
//

Text Mined References (52)

PMID Year Title
27151216 2016 Differential AMP-activated Protein Kinase (AMPK) Recognition Mechanism of Ca2+/Calmodulin-dependent Protein Kinase Kinase Isoforms.
26824050 2016 Clopidogrel Protects Endothelium by Hindering TNF?-Induced VCAM-1 Expression through CaMKK?/AMPK/Nrf2 Pathway.
26552607 2016 Nucleoporin 62 and Ca(2+)/calmodulin dependent kinase kinase 2 regulate androgen receptor activity in castrate resistant prostate cancer cells.
25847065 2015 The camKK2/camKIV relay is an essential regulator of hepatic cancer.
25756516 2015 Calcium calmodulin dependent kinase kinase 2 - a novel therapeutic target for gastric adenocarcinoma.
25679868 2015 Role of Ca(2+)/calmodulin-dependent protein kinase kinase in adrenal aldosterone production.
25590814 2015 CaMKK?-AMPK?2 signaling contributes to mitotic Golgi fragmentation and the G2/M transition in mammalian cells.
25394900 2015 MicroRNA-224 and its target CAMKK2 synergistically influence tumor progression and patient prognosis in prostate cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23958956 2014 Convergent lines of evidence support CAMKK2 as a schizophrenia susceptibility gene.
23754392 2013 Ca2+/calmodulin-dependent protein kinase kinase ? phosphorylation of Sirtuin 1 in endothelium is atheroprotective.
23465592 2013 S-allyl cysteine attenuates free fatty acid-induced lipogenesis in human HepG2 cells through activation of the AMP-activated protein kinase-dependent pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23110126 2012 CaMKK? is involved in AMP-activated protein kinase activation by baicalin in LKB1 deficient cell lines.
23027865 2012 Withdrawal of essential amino acids increases autophagy by a pathway involving Ca2+/calmodulin-dependent kinase kinase-? (CaMKK-?).
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22778263 2012 Calcium/calmodulin-dependent protein kinase kinase 2: roles in signaling and pathophysiology.
22654108 2012 A regulatory feedback loop between Ca2+/calmodulin-dependent protein kinase kinase 2 (CaMKK2) and the androgen receptor in prostate cancer progression.
21957496 Differential effects of PKA-controlled CaMKK2 variants on neuronal differentiation.
21807092 2011 Characterization of the CaMKK?-AMPK signaling complex.
21670147 2011 Hypoxia triggers AMPK activation through reactive oxygen species-mediated activation of calcium release-activated calcium channels.
21669867 2011 Ca2+/Calmodulin-dependent protein kinase kinase beta is regulated by multisite phosphorylation.
21084482 2011 Inhibition of calmodulin-dependent kinase kinase blocks human cytomegalovirus-induced glycolytic activation and severely attenuates production of viral progeny.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20018878 2010 Mechanism and role of high density lipoprotein-induced activation of AMP-activated protein kinase in endothelial cells.
19958286 2010 Calmodulin-dependent protein kinase kinase-beta activates AMPK without forming a stable complex: synergistic effects of Ca2+ and AMP.
19763792 2010 ERK activation and cell growth require CaM kinases in MCF-7 breast cancer cells.
19667195 2009 Single-molecule force spectroscopy distinguishes target binding modes of calmodulin.
19407487 2009 Inhibition of cervical cancer cell growth through activation of upstream kinases of AMP-activated protein kinase.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18436530 2008 Muscarinic receptor activation of AMP-activated protein kinase inhibits orexigenic neuropeptide mRNA expression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17197037 2007 Association of polymorphisms in P2RX7 and CaMKKb with anxiety disorders.
16880506 2006 Thrombin activates AMP-activated protein kinase in endothelial cells via a pathway involving Ca2+/calmodulin-dependent protein kinase kinase beta.
16673375 2006 Analysis of single nucleotide polymorphisms in genes in the chromosome 12Q24.31 region points to P2RX7 as a susceptibility gene to bipolar affective disorder.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16247765 2006 Increased expression of calcium/calmodulin-dependent protein kinase IIbeta in frontal cortex in schizophrenia and depression.
16054096 2005 Ca2+/calmodulin-dependent protein kinase kinase-beta acts upstream of AMP-activated protein kinase in mammalian cells.
16054095 2005 Calmodulin-dependent protein kinase kinase-beta is an alternative upstream kinase for AMP-activated protein kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12935886 2003 Identification and characterization of novel components of a Ca2+/calmodulin-dependent protein kinase cascade in HeLa cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11395482 2001 Human Ca2+/calmodulin-dependent protein kinase kinase beta gene encodes multiple isoforms that display distinct kinase activity.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9822657 1998 Components of a calmodulin-dependent protein kinase cascade. Molecular cloning, functional characterization and cellular localization of Ca2+/calmodulin-dependent protein kinase kinase beta.
9662074 1998 Cloning, expression and chromosomal localization of human Ca2+/calmodulin-dependent protein kinase kinase.