Property Summary

Ligand Count 7
NCBI Gene PubMed Count 50
PubMed Score 125.46
PubTator Score 80.58

Knowledge Summary

Patent (3,875)

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.200 1.1e-02
aldosterone-producing adenoma -1.119 2.1e-02
astrocytic glioma -1.300 3.3e-03
Astrocytoma, Pilocytic -1.900 1.8e-03
atypical teratoid / rhabdoid tumor -1.500 5.6e-06
cystic fibrosis 1.054 3.8e-04
ependymoma -1.500 1.7e-03
glioblastoma -1.700 9.2e-05
group 4 medulloblastoma -1.500 1.2e-02
medulloblastoma, large-cell -1.500 8.4e-05
oligodendroglioma -1.100 3.5e-02
osteosarcoma -3.001 1.5e-08
ovarian cancer 1.700 1.5e-06
pancreatic ductal adenocarcinoma liver m... 1.494 5.6e-03
Pick disease -1.600 1.1e-03
primitive neuroectodermal tumor -1.800 6.8e-06
psoriasis -1.300 3.0e-04
subependymal giant cell astrocytoma -3.318 1.0e-03

Gene RIF (41)

AA Sequence

MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLAR      1 - 70
DRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRL     71 - 140
PRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRR    141 - 210
PPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPT    211 - 280
LKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGT    281 - 350
PAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK    351 - 420
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVILVKTM    421 - 490
IRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQPPGHRPAPRGGGGSALVRGSP    491 - 560
CVESCWAPAPGSPARMHPLRPEEAMEPE                                              561 - 588
//

Text Mined References (59)

PMID Year Title