Property Summary

NCBI Gene PubMed Count 70
PubMed Score 141.59
PubTator Score 120.02

Knowledge Summary

Patent (14,979)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.600 1.4e-03
posterior fossa group A ependymoma -4.500 2.8e-15
oligodendroglioma -1.700 1.7e-02
glioblastoma -4.600 2.5e-08
osteosarcoma -1.620 1.9e-02
medulloblastoma -2.700 3.9e-05
cystic fibrosis 2.980 9.1e-07
atypical teratoid / rhabdoid tumor -4.400 4.4e-08
medulloblastoma, large-cell -3.600 7.1e-07
primitive neuroectodermal tumor -2.800 1.2e-04
pediatric high grade glioma -4.000 9.8e-08
pilocytic astrocytoma -4.000 1.4e-08
sarcoidosis -1.400 7.8e-06
subependymal giant cell astrocytoma -5.126 5.0e-03
Pick disease -1.500 7.3e-03

Protein-protein Interaction (6)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (33)

PMID Text
26909912 The T-allele of rs10491334 in CAMK4 was associated with hypertension in the Uygur group.
25446257 Expression of CaMKIV inhibits autophosphorylation and activation of CaMKII, and elicits G0/G1cell cycle arrest,impairing cell proliferation.
24667640 CaMK4-dependent activation of AKT/mTOR and CREM-alpha underlies autoimmunity-associated Th17 imbalance.
24442360 An imbalance of specific isoforms of CYFIP1, an FMRP interaction partner, and CAMK4, a transcriptional regulator of the FMRP gene, modulates risk for autism spectrum disorders.
23103515 Phosphorylated Notch1-IC by CaMKIV increases Notch1-IC stability, which enhances osteoclast differentiation.
23049845 CaMK4 regulates beta-cell proliferation and apoptosis in a CREB-dependent manner and CaMK4-induced IRS-2 expression is important in these processes
22897820 study suggests that the mutations in CAMK4 may lead to abnormal semen parameters
21612516 Prolongevity genes are activated by CAMKIV, the levels of which are influenced by rs10491334, a single-nucleotide polymorphism associated with human longevity.
21514275 The regulation of RORalpha activity by PKA as well as CaMK-IV provides a new link in the signalling network that regulates metabolic processes such as glycogen and lipid metabolism.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20378615 Observational study of gene-disease association. (HuGE Navigator)
20171262 These findings suggest that PLC/CAMK IV-NF-kappaB is involved in RAGE mediated signaling pathway in human endothelial cells.
19633294 Data show that RA-induced repression of the CaMKIV signaling pathway may represent an early event in retinoid-dependent neuronal differentiation.
19538941 these data indicate that the B subunits alpha and delta are essential for the interaction of PP2A with CaMKIV.
19506079 analysis of regulation of calcium/calmodulin-dependent kinase IV by O-GlcNAc modification
19436069 CaMKIV is a molecular link between Group I mGluRs and fragile X mental retardation protein in anterior cingulate cortex neurons
19386606 a group of RNA elements are responsive to PKA and CaMKIV from in vivo selection
19100722 HIV-1 gp120-induced neuron death is inhibited by CCL3L1 treatment via the phosphorylation of CREB, the upregulation of Bcl-2, and the PKA and CaMKI/CaMKIV cell signaling pathways
19017650 hnRNP L is an essential component of CaMKIV-regulated alternative splicing through CA repeats, with its phosphorylation likely playing a critical role.
19001277 CaMKIV plays a critical role in the development and persistence of cocaine-induced behaviors, through mechanisms dissociated from acute effects on gene expression and CREB-dependent transcription.
18829949 CaMK-4 expression correlates positively with the ability to form long-term memory and implicates the decline of CaMKIV signaling mechanisms in age-related memory deficits.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18606955 Observational study of gene-disease association. (HuGE Navigator)
18053176 Transgenic CaMKIV plays a modulatory role in the nucleus accumbens in anxiety-like behavior of adult CaMKIV variant mice.
17909078 a novel link between TLR4 and a calcium-dependent signaling cascade comprising CaMKIV-CREB-Bcl-2 that is essential for DC survival.
15841182 Results identify calcium/calmodulin-dependent kinase IV as being responsible for the increased expression of CREM and the decreased production of interleukin-2 in systemic lupus erythematosus T cells.
15840651 CaMKIV is expressed in human sperm and may have a role in the regulation of human sperm motility
15665723 the function of CaMK II is essential for PAF-induced macrophage priming, while CaMK IV is not specific for priming by PAF and appears to have a direct link in TLR4-mediated events
15591024 calcium/CaMKIV signaling pathway may play an important role in the excitation-mediated regulation of corticotropin releasing hormone synthesis
15143065 the Ca(2+)/CaM binding-autoinhibitory domain of CaMKIV is required for association of the kinase with PP2A
14701808 sequestration of CaMKK may be the molecular mechanism by which catalytically inactive mutants of CaMKIV exert their "dominant-negative" functions within the cell
12065094 CaMKIV proteins were found in the nucleus of epithelial ovarian cancer tissue. CaMKIV expression was significantly associated with clinical stage (P<0.01), histological grade (P<0.01), and clinical outcome (P<0.01).

AA Sequence

MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIVYRCKQKGTQK      1 - 70
PYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERD     71 - 140
AADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAP    141 - 210
EILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKL    211 - 280
IVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQ    281 - 350
ESHKASRDPSPIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA    351 - 420
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY                     421 - 473
//

Text Mined References (82)

PMID Year Title
26909912 2016 CAMK4 gene variation is associated with hypertension in a Uygur population.
25446257 2015 A novel crosstalk between calcium/calmodulin kinases II and IV regulates cell proliferation in myeloid leukemia cells.
25226531 2014 Common variation near ROBO2 is associated with expressive vocabulary in infancy.
24667640 2014 CaMK4-dependent activation of AKT/mTOR and CREM-? underlies autoimmunity-associated Th17 imbalance.
24442360 2014 Common variants in genes of the postsynaptic FMRP signalling pathway are risk factors for autism spectrum disorders.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23103515 2013 Calcium/calmodulin-dependent protein kinase IV (CaMKIV) enhances osteoclast differentiation via the up-regulation of Notch1 protein stability.
23049845 2012 The CaMK4/CREB/IRS-2 cascade stimulates proliferation and inhibits apoptosis of ?-cells.
22897820 2012 Novel mutations in calcium/calmodulin-dependent protein kinase IV (CAMK4) gene in infertile men.
21612516 2011 Association study on long-living individuals from Southern Italy identifies rs10491334 in the CAMKIV gene that regulates survival proteins.
21514275 2011 Protein kinase A activates and phosphorylates ROR?4 in vitro and takes part in ROR? activation by CaMK-IV.
21269460 2011 Initial characterization of the human central proteome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
20171262 2010 PLC/CAMK IV-NF-kappaB involved in the receptor for advanced glycation end products mediated signaling pathway in human endothelial cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19633294 2009 Repression of Ca2+/calmodulin-dependent protein kinase IV signaling accelerates retinoic acid-induced differentiation of human neuroblastoma cells.
19538941 2009 The Balpha and Bdelta regulatory subunits of PP2A are necessary for assembly of the CaMKIV.PP2A signaling complex.
19506079 2009 Regulation of calcium/calmodulin-dependent kinase IV by O-GlcNAc modification.
19436069 2009 Ca2+/calmodulin-dependent protein kinase IV links group I metabotropic glutamate receptors to fragile X mental retardation protein in cingulate cortex.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19386606 2009 In vivo selection of kinase-responsive RNA elements controlling alternative splicing.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19017650 2009 The heterogeneous nuclear ribonucleoprotein L is an essential component in the Ca2+/calmodulin-dependent protein kinase IV-regulated alternative splicing through cytidine-adenosine repeats.
19001277 2008 Loss of the Ca2+/calmodulin-dependent protein kinase type IV in dopaminoceptive neurons enhances behavioral effects of cocaine.
18930438 2008 Calcium/calmodulin-dependent kinase IV in immune and inflammatory responses: novel routes for an ancient traveller.
18829949 2008 Upregulation of calcium/calmodulin-dependent protein kinase IV improves memory formation and rescues memory loss with aging.
18817731 2008 Calmodulin-kinases: modulators of neuronal development and plasticity.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18606955 2008 Systematic analysis of glutamatergic neurotransmission genes in alcohol dependence and adolescent risky drinking behavior.
18053176 2007 Adeno-associated virus (AAV)-mediated suppression of Ca2+/calmodulin kinase IV activity in the nucleus accumbens modulates emotional behaviour in mice.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17909078 2008 Calmodulin-dependent kinase IV links Toll-like receptor 4 signaling with survival pathway of activated dendritic cells.
17903302 2007 Framingham Heart Study 100K Project: genome-wide associations for blood pressure and arterial stiffness.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15841182 2005 Systemic lupus erythematosus serum IgG increases CREM binding to the IL-2 promoter and suppresses IL-2 production through CaMKIV.
15840651 2005 Evidence of the presence of calcium/calmodulin-dependent protein kinase IV in human sperm and its involvement in motility regulation.
15769749 2005 The autonomous activity of calcium/calmodulin-dependent protein kinase IV is required for its role in transcription.
15680915 2005 Identification of major Ca(2+)/calmodulin-dependent protein kinase phosphatase-binding proteins in brain: biochemical analysis of the interaction.
15665723 2005 Calcium/calmodulin-dependent kinase II is required for platelet-activating factor priming.
15591024 2004 Calcium/calmodulin kinase IV pathway is involved in the transcriptional regulation of the corticotropin-releasing hormone gene promoter in neuronal cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15143065 2004 Regulation and function of the calcium/calmodulin-dependent protein kinase IV/protein serine/threonine phosphatase 2A signaling complex.
14701808 2004 Catalytic activity is required for calcium/calmodulin-dependent protein kinase IV to enter the nucleus.
12630910 2003 Post-synaptic density-95 promotes calcium/calmodulin-dependent protein kinase II-mediated Ser847 phosphorylation of neuronal nitric oxide synthase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12065094 2002 Ca(2+)/calmodulin-dependent protein kinase IV expression in epithelial ovarian cancer.
11970865 2002 Phosphorylation of CBP mediates transcriptional activation by neural activity and CaM kinase IV.
11572782 2001 An important role of neural activity-dependent CaMKIV signaling in the consolidation of long-term memory.
11470791 2001 The modular nature of histone deacetylase HDAC4 confers phosphorylation-dependent intracellular trafficking.
11395482 2001 Human Ca2+/calmodulin-dependent protein kinase kinase beta gene encodes multiple isoforms that display distinct kinase activity.
11274168 2001 Ca2+/calmodulin-dependent protein kinase IV stimulates nuclear factor-kappa B transactivation via phosphorylation of the p65 subunit.
10932193 2000 Spermiogenesis and exchange of basic nuclear proteins are impaired in male germ cells lacking Camk4.
10874031 2000 Inhibition of neuronal nitric-oxide synthase by calcium/ calmodulin-dependent protein kinase IIalpha through Ser847 phosphorylation in NG108-15 neuronal cells.
10681496 2000 WD40 repeat proteins striatin and S/G(2) nuclear autoantigen are members of a novel family of calmodulin-binding proteins that associate with protein phosphatase 2A.
10617605 2000 Ca(2+)-dependent gene expression mediated by MEF2 transcription factors.
10400690 1999 Regulation of neuronal nitric-oxide synthase by calmodulin kinases.
9920409 1998 Calmodulin-dependent protein kinase IV: regulation of function and expression.
9822657 1998 Components of a calmodulin-dependent protein kinase cascade. Molecular cloning, functional characterization and cellular localization of Ca2+/calmodulin-dependent protein kinase kinase beta.
9705275 1998 Characterization of the mechanism of regulation of Ca2+/ calmodulin-dependent protein kinase I by calmodulin and by Ca2+/calmodulin-dependent protein kinase kinase.
9154845 1997 Regulation of microtubule dynamics by Ca2+/calmodulin-dependent kinase IV/Gr-dependent phosphorylation of oncoprotein 18.
8980227 1996 CREB phosphorylation and dephosphorylation: a Ca(2+)- and stimulus duration-dependent switch for hippocampal gene expression.
8855261 1996 Regulation of mitogen-activated protein kinases by a calcium/calmodulin-dependent protein kinase cascade.
8702940 1996 A unique phosphorylation-dependent mechanism for the activation of Ca2+/calmodulin-dependent protein kinase type IV/GR.
8621423 1996 Requirements for calcium and calmodulin in the calmodulin kinase activation cascade.
8397199 1993 Expression of a Ca2+/calmodulin-dependent protein kinase, CaM kinase-Gr, in human T lymphocytes. Regulation of kinase activity by T cell receptor signaling.
8194751 1994 The cDNA sequence and characterization of the Ca2+/calmodulin-dependent protein kinase-Gr from human brain and thymus.
8107230 1994 A Ca2+/calmodulin-dependent protein kinase, CaM kinase-Gr, expressed after transformation of primary human B lymphocytes by Epstein-Barr virus (EBV) is induced by the EBV oncogene LMP1.
8089075 1994 cDNA cloning and expression of human calmodulin-dependent protein kinase IV.
8065343 1994 Calcium/calmodulin-dependent protein kinase types II and IV differentially regulate CREB-dependent gene expression.
7961813 1994 Activation mechanisms for Ca2+/calmodulin-dependent protein kinase IV. Identification of a brain CaM-kinase IV kinase.
7615569 1995 Phosphorylation and activation of Ca(2+)-calmodulin-dependent protein kinase IV by Ca(2+)-calmodulin-dependent protein kinase Ia kinase. Phosphorylation of threonine 196 is essential for activation.
2536634 1989 Chromosomal localization of the human gene for brain Ca2+/calmodulin-dependent protein kinase type IV.
2011593 1991 Nuclear and axonal localization of Ca2+/calmodulin-dependent protein kinase type Gr in rat cerebellar cortex.
1375933 1992 Nitric oxide synthase regulatory sites. Phosphorylation by cyclic AMP-dependent protein kinase, protein kinase C, and calcium/calmodulin protein kinase; identification of flavin and calmodulin binding sites.