Property Summary

Ligand Count 15
NCBI Gene PubMed Count 67
PubMed Score 16.93
PubTator Score 21.97

Knowledge Summary

Patent (3,199)

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.200 6.1e-03
Amyotrophic lateral sclerosis 1.029 5.2e-05
Astrocytoma, Pilocytic 1.600 1.5e-05
Breast cancer -1.300 3.0e-05
cystic fibrosis -1.266 2.1e-05
cystic fibrosis and chronic rhinosinusit... -1.078 4.2e-03
diabetes mellitus -1.200 1.2e-03
ependymoma -1.300 4.3e-02
glioblastoma 1.200 3.6e-04
group 3 medulloblastoma 1.500 2.0e-02
intraductal papillary-mucinous adenoma (... 1.600 2.3e-03
intraductal papillary-mucinous carcinoma... 1.700 5.4e-03
intraductal papillary-mucinous neoplasm ... 1.700 1.8e-02
juvenile dermatomyositis 1.037 8.5e-08
medulloblastoma, large-cell -1.700 2.9e-04
osteosarcoma 2.854 2.0e-04
ovarian cancer -2.400 2.1e-12
pancreatic cancer 1.400 2.1e-03
Pick disease -1.100 5.4e-03
primary pancreatic ductal adenocarcinoma 1.571 9.4e-04
primary Sjogren syndrome 1.300 5.9e-07
tuberculosis 1.200 1.7e-06
ulcerative colitis -1.100 2.1e-06

Gene RIF (25)

AA Sequence

MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKH      1 - 70
PNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPE     71 - 140
NLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVG    141 - 210
YPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVAS    211 - 280
MMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEI    281 - 350
IKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH    351 - 420
LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFS    421 - 490
GGTSLWQNI                                                                 491 - 499
//

Text Mined References (79)

PMID Year Title