Property Summary

Ligand Count 2
NCBI Gene PubMed Count 73
PubMed Score 13.64
PubTator Score 51.24

Knowledge Summary

Patent (12,914)

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -4.000 6.0e-07
astrocytic glioma -3.100 7.2e-03
Astrocytoma, Pilocytic -3.400 8.4e-11
atypical teratoid / rhabdoid tumor -5.900 4.4e-12
ependymoma -2.600 3.7e-02
glioblastoma -3.700 9.1e-10
group 3 medulloblastoma -1.500 4.4e-03
inflammatory breast cancer -1.700 3.3e-04
lung carcinoma 3.500 1.9e-58
medulloblastoma, large-cell -3.800 2.1e-08
oligodendroglioma -1.200 1.2e-02
osteosarcoma 1.474 2.7e-08
primitive neuroectodermal tumor -2.800 4.7e-05
psoriasis 1.400 2.6e-04

Gene RIF (28)

AA Sequence

MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKH      1 - 70
SNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPE     71 - 140
NLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWACGVILYILLVG    141 - 210
YPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVAS    211 - 280
MMHRQETVECLKKFNARRKLKGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKAD    281 - 350
GVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVR    351 - 420
RGSGAPEAEGPLPCPSPAPFSPLPAPSPRISDILNSVRRGSGTPEAEGPLSAGPPPCLSPALLGPLSSPS    421 - 490
PRISDILNSVRRGSGTPEAEGPSPVGPPPCPSPTIPGPLPTPSRKQEIIKTTEQLIEAVNNGDFEAYAKI    491 - 560
CDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQG    561 - 630
RPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ                                      631 - 666
//

Text Mined References (79)

PMID Year Title