Property Summary

NCBI Gene PubMed Count 70
PubMed Score 52.66
PubTator Score 51.24

Knowledge Summary

Patent (12,914)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -3.100 7.2e-03
posterior fossa group A ependymoma -3.300 4.7e-12
oligodendroglioma -2.500 1.1e-14
psoriasis -2.500 1.1e-83
glioblastoma -4.200 3.4e-06
osteosarcoma 1.474 2.7e-08
sonic hedgehog group medulloblastoma -4.300 3.8e-10
atypical teratoid / rhabdoid tumor -5.900 4.4e-12
medulloblastoma, large-cell -3.800 2.1e-08
primitive neuroectodermal tumor -2.800 4.7e-05
pediatric high grade glioma -4.000 1.5e-08
pilocytic astrocytoma -3.400 1.0e-10
inflammatory breast cancer -1.700 3.3e-04
lung carcinoma 3.500 1.9e-58

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (25)

PMID Text
25045698 Due to similarity of structure variations, we suggest that these compounds may have an effect on beta-CaMKII and that sengesterone may have a similar efficacy as the control.
22750393 beta-carotene reverses the IL-1beta-mediated reduction in paraoxonase-1 expression via induction of the CaMKKII pathway in human endothelial cells
21884935 Study presents the crystal structure of an autoinhibited full-length human CaMKII holoenzyme, revealing an unexpected compact arrangement of kinase domains docked against a central hub, with the calmodulin-binding sites completely inaccessible.
21871176 Promoter methylations of CAMK2B and ARFGEF1 are novel epigenetic markers identified in breast cancer cell lines.
21610080 Characterization of a central Ca2+/calmodulin-dependent protein kinase IIalpha/beta binding domain in densin that selectively modulates glutamate receptor subunit phosphorylation.
21479273 The novel cGMP/PKG/ROS/calmodulin/CaMKII signaling pathway may regulate cardiomyocyte excitability by opening K(ATP) channels and contribute to cardiac protection against ischemia-reperfusion injury.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
18302935 These FLIM versions of Camui could be useful for elucidating the function of CaMKII both in vitro and in vivo.
17419996 regulated degradation of liprinalpha1 is important for proper LAR receptor distribution, and could provide a mechanism for localized control of dendrite and synapse morphogenesis by activity and CaMKII.
17202341 Tat-induced IL-10 expression is regulated by p38 MAPK- and CaMK II-activated CREB-1 as well as Sp-1 transcription factors
16247765 expression significantly elevated in frontal cortex in schizophrenia & depression; because CaMKIIbeta influences expression of neuroreceptors & neural outgrowth & pruning, altered expression in schizophrenia or depression may contribute to these diseases
16247765 The expression of CaMKII beta was significantly elevated in schizophrenia and in depression.
16126727 thrombomodulin induces Ca2+ signals and nitric oxide synthesis through EGFR and calmodulin kinase II
15792370 presence of a CaMKIIbeta isoform that can target the SR presumably via its membrane anchor alphaKAP defines a previously unrecognized Ca2+/CaM regulatory system in myocardium
15665723 the function of CaMK II is essential for PAF-induced macrophage priming, while CaMK IV is not specific for priming by PAF and appears to have a direct link in TLR4-mediated events
14722083 measured differences in CaMKII binding affinities for CaM play a minor role in the autophosphorylation of the enzyme, largely dictated by autophosphorylation rate for alpha, beta, gamma and delta isoforms
14565989 exercise increases the activity of CaMKII in skeletal muscle, suggesting that it may have a role in regulating skeletal muscle function and metabolism during exercise in humans
12496285 CaMK II regulates c-FLIP expression and phosphorylation, thus modulating Fas-mediated signaling in glioma cells
11889801 role in cell communication
11867691 Tat-induced IL-10 expression is regulated by p38 MAPK- and CaMK II-activated CREB-1 as well as Sp-1 transcription factors
11751951 Tat-induced IL-10 expression is regulated by p38 MAPK- and CaMK II-activated CREB-1 as well as Sp-1 transcription factors
11710563 Four distinct isoforms of CAMKII were isolated. Two of them were characterized as CaMKII alpha and beta subunits.expression is developmentally regulated in both human fetal and adult brain to different degrees
11042361 mRNA levels are elevated in the frontal cortex in schizophrenia.

AA Sequence

MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKH      1 - 70
SNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPE     71 - 140
NLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWACGVILYILLVG    141 - 210
YPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVAS    211 - 280
MMHRQETVECLKKFNARRKLKGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKAD    281 - 350
GVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVR    351 - 420
RGSGAPEAEGPLPCPSPAPFSPLPAPSPRISDILNSVRRGSGTPEAEGPLSAGPPPCLSPALLGPLSSPS    421 - 490
PRISDILNSVRRGSGTPEAEGPSPVGPPPCPSPTIPGPLPTPSRKQEIIKTTEQLIEAVNNGDFEAYAKI    491 - 560
CDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQG    561 - 630
RPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ                                      631 - 666
//

Text Mined References (76)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25045698 2014 Possible inhibitor from traditional Chinese medicine for the ? form of calcium-dependent protein kinase type II in the treatment of major depressive disorder.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23989986 2014 A meta-analysis of genome-wide association studies identifies novel variants associated with osteoarthritis of the hip.
22750393 2012 ?-carotene reverses the IL-1?-mediated reduction in paraoxonase-1 expression via induction of the CaMKKII pathway in human endothelial cells.
22399527 2012 Genome-wide screen for metabolic syndrome susceptibility Loci reveals strong lipid gene contribution but no evidence for common genetic basis for clustering of metabolic syndrome traits.
21884935 2011 A mechanism for tunable autoinhibition in the structure of a human Ca2+/calmodulin- dependent kinase II holoenzyme.
21871176 2011 Downregulation of ARFGEF1 and CAMK2B by promoter hypermethylation in breast cancer cells.
21610080 2011 Characterization of a central Ca2+/calmodulin-dependent protein kinase IIalpha/beta binding domain in densin that selectively modulates glutamate receptor subunit phosphorylation.
21529938 2011 Analysis of CaM-kinase signaling in cells.
21479273 2011 Activation of cGMP-dependent protein kinase stimulates cardiac ATP-sensitive potassium channels via a ROS/calmodulin/CaMKII signaling cascade.
20668654 2010 Structure of the CaMKIIdelta/calmodulin complex reveals the molecular mechanism of CaMKII kinase activation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19996366 2009 The roles of CaMKII and F-actin in the structural plasticity of dendritic spines: a potential molecular identity of a synaptic tag?
19369195 2009 Large-scale proteomics analysis of the human kinome.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18817731 2008 Calmodulin-kinases: modulators of neuronal development and plasticity.
18311135 2008 Motor protein-dependent transport of AMPA receptors into spines during long-term potentiation.
18302935 2008 Genetically encoded probe for fluorescence lifetime imaging of CaMKII activity.
18218981 2008 Ca2+/calmodulin-dependent protein kinase IIdelta and protein kinase D overexpression reinforce the histone deacetylase 5 redistribution in heart failure.
17419996 2007 Liprinalpha1 degradation by calcium/calmodulin-dependent protein kinase II regulates LAR receptor tyrosine phosphatase distribution and dendrite development.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16690701 2006 Ca2+-calmodulin-dependent protein kinase expression and signalling in skeletal muscle during exercise.
16436603 2006 Transition from reversible to persistent binding of CaMKII to postsynaptic sites and NR2B.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16247765 2006 Increased expression of calcium/calmodulin-dependent protein kinase IIbeta in frontal cortex in schizophrenia and depression.
16185778 2005 CaMK-II oligomerization potential determined using CFP/YFP FRET.
16126727 2005 Endothelial thrombomodulin induces Ca2+ signals and nitric oxide synthesis through epidermal growth factor receptor kinase and calmodulin kinase II.
15792370 2005 Alternative splicing generates a CaM kinase IIbeta isoform in myocardium that targets the sarcoplasmic reticulum through a putative alphaKAP and regulates GAPDH.
15665723 2005 Calcium/calmodulin-dependent kinase II is required for platelet-activating factor priming.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15312654 2004 SynGAP-MUPP1-CaMKII synaptic complexes regulate p38 MAP kinase activity and NMDA receptor-dependent synaptic AMPA receptor potentiation.
15294044 2004 The role of calcium and calcium/calmodulin-dependent kinases in skeletal muscle plasticity and mitochondrial biogenesis.
15199064 2004 The muscle-specific calmodulin-dependent protein kinase assembles with the glycolytic enzyme complex at the sarcoplasmic reticulum and modulates the activity of glyceraldehyde-3-phosphate dehydrogenase in a Ca2+/calmodulin-dependent manner.
14722083 2004 Comparative analyses of the three-dimensional structures and enzymatic properties of alpha, beta, gamma and delta isoforms of Ca2+-calmodulin-dependent protein kinase II.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14622581 2003 The NMDA receptor is coupled to the ERK pathway by a direct interaction between NR2B and RasGRF1.
14565989 2003 Exercise increases Ca2+-calmodulin-dependent protein kinase II activity in human skeletal muscle.
12853948 2003 The DNA sequence of human chromosome 7.
12815021 2003 Activation of peripheral NMDA receptors contributes to human pain and rat afferent discharges evoked by injection of glutamate into the masseter muscle.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12496285 2003 Calcium/calmodulin-dependent protein kinase II regulation of c-FLIP expression and phosphorylation in modulation of Fas-mediated signaling in malignant glioma cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475968 2002 Calcium regulation of GM-CSF by calmodulin-dependent kinase II phosphorylation of Ets1.
12147342 2002 Sequence determinants on the NR2A and NR2B subunits of NMDA receptor responsible for specificity of phosphorylation by CaMKII.
11889801 2002 [Molecular mechanisms of the intracellular localizations of Ca2+/calmodulin-dependent protein kinase II isoforms, and their physiological functions].
11867691 2002 Beta(3)-mediated engulfment of apoptotic tumor cells by dendritic cells is dependent on CAMKII: inhibition by HIV-1 Tat.
11751951 2002 NK cell activation by dendritic cells is dependent on LFA-1-mediated induction of calcium-calmodulin kinase II: inhibition by HIV-1 Tat C-terminal domain.
11710563 2001 Molecular cloning and sequence analyses of calcium/calmodulin-dependent protein kinase II from fetal and adult human brain. Sequence analyses of human brain calciuum/calmodulin-dependent protein kinase II.
11468283 2001 Inositol 1,4,5-trisphosphate 3-kinase A associates with F-actin and dendritic spines via its N terminus.
11325525 2001 KN-93 inhibition of G protein signaling is independent of the ability of Ca2+/calmodulin-dependent protein kinase II to phosphorylate phospholipase Cbeta3 on 537-Ser.
11306676 2001 Evidence for direct protein kinase-C mediated modulation of N-methyl-D-aspartate receptor current.
11160423 2001 Densin-180 forms a ternary complex with the (alpha)-subunit of Ca2+/calmodulin-dependent protein kinase II and (alpha)-actinin.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11042361 2000 Schizophrenia: elevated mRNA for calcium-calmodulin-dependent protein kinase IIbeta in frontal cortex.
11013247 2001 Calmodulin kinase II attenuation of gene transcription by preventing cAMP response element-binding protein (CREB) dimerization and binding of the CREB-binding protein.
10858498 2000 Identification of alternative splicing variants of the beta subunit of human Ca(2+)/calmodulin-dependent protein kinase II with different activities.
10819240 2000 Cloning and quantitative determination of the human Ca2+/calmodulin-dependent protein kinase II (CaMK II) isoforms in human beta cells.
10373510 1999 Ras-specific exchange factor GRF: oligomerization through its Dbl homology domain and calcium-dependent activation of Raf.
9724800 1998 Characterization of a calmodulin kinase II inhibitor protein in brain.
9481670 1998 Adjacent asparagines in the NR2-subunit of the NMDA receptor channel control the voltage-dependent block by extracellular Mg2+.
9115241 1997 Rad and Rad-related GTPases interact with calmodulin and calmodulin-dependent protein kinase II.
9110174 1997 Large-scale concatenation cDNA sequencing.
9060999 1997 Identification of novel human tumor cell-specific CaMK-II variants.
8940188 1996 Identification of a phosphorylation site for calcium/calmodulindependent protein kinase II in the NR2B subunit of the N-methyl-D-aspartate receptor.
8665664 1995 Developmental rearrangements of cortical glutamate-NMDA receptor binding sites in late human gestation.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8615909 1996 Expression of Ca2+/calmodulin-dependent protein kinase types II and IV, and reduced DNA synthesis due to the Ca2+/calmodulin-dependent protein kinase inhibitor KN-62 (1-[N,O-bis(5-isoquinolinesulfonyl)-N-methyl-L-tyrosyl]-4-phenyl piperazine) in small cell lung carcinoma.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7758473 1995 Characterization and expression of multiple alternatively spliced transcripts of the Goodpasture antigen gene region. Goodpasture antibodies recognize recombinant proteins representing the autoantigen and one of its alternative forms.
3417668 1988 Ca2+/calmodulin-dependent protein kinase II. Identification of a regulatory autophosphorylation site adjacent to the inhibitory and calmodulin-binding domains.
2842767 1988 Ca2+/calmodulin-dependent protein kinase II: identification of threonine-286 as the autophosphorylation site in the alpha subunit associated with the generation of Ca2+-independent activity.