Property Summary

Ligand Count 4
NCBI Gene PubMed Count 139
PubMed Score 50.89
PubTator Score 46.49

Knowledge Summary

Patent (2,660)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.900 1.2e-03
astrocytic glioma -2.400 1.4e-03
Astrocytoma, Pilocytic -2.900 5.3e-06
atypical teratoid / rhabdoid tumor -4.400 1.2e-10
ependymoma -3.500 4.8e-04
glioblastoma -3.000 2.2e-08
group 3 medulloblastoma -3.700 2.2e-03
malignant mesothelioma -1.200 1.1e-06
medulloblastoma, large-cell -4.200 2.7e-04
oligodendroglioma -2.400 1.4e-02
osteosarcoma 1.018 6.8e-04
ovarian cancer 1.300 4.9e-11
primitive neuroectodermal tumor -4.100 1.3e-05

Gene RIF (55)

AA Sequence

MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHP      1 - 70
NIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPEN     71 - 140
LLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGY    141 - 210
PPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASC    211 - 280
MHRQETVDCLKKFNARRKLKGAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEI    281 - 350
IKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH    351 - 420
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH                421 - 478
//

Text Mined References (141)

PMID Year Title