Property Summary

NCBI Gene PubMed Count 133
PubMed Score 47.54
PubTator Score 46.49

Knowledge Summary

Patent (2,660)

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.200 1.1e-06
astrocytic glioma -2.400 1.4e-03
posterior fossa group B ependymoma -3.600 1.2e-10
oligodendroglioma -2.400 1.4e-02
glioblastoma -4.300 3.8e-07
osteosarcoma 1.018 6.8e-04
medulloblastoma -4.800 1.2e-09
atypical teratoid / rhabdoid tumor -4.400 1.2e-10
medulloblastoma, large-cell -4.200 2.7e-04
primitive neuroectodermal tumor -4.100 1.3e-05
pediatric high grade glioma -3.000 6.3e-06
pilocytic astrocytoma -2.900 6.1e-06
ovarian cancer 1.300 4.9e-11

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (51)

PMID Text
25815641 CaMKII phosphorylates SCN5A in vitro on 23 novel serine sites as was identified by mass spectrometry; reduced S516 phosphorylation has been found in human heart failure.
25290264 Ca2+/calmodulin-dependent protein kinase-II (CaMKII) has a key role in the plasticity of glutamatergic synapses of the brain.
24855644 a novel regulation of CaMKII by another second messenger system and indicate its involvement in excitotoxic neuronal cell death.
24614225 CaMKII-mediated recruitment and upregulation of CYLD is expected to remove K63-linked polyubiquitins and facilitate proteasomal degradation at the postsynaptic density.
24407174 Overexpression of a T253D phosphomimic form of calcium/calmodulin-dependent protein kinase type II subunit alpha significantly decreases proliferation, and cells accumulate in mitosis, specifically in metaphase.
24384746 CAMK2A SNPs were associated with Alzheimer disease and mild cognitive impairment. AG genotype at the CAMK2A-rs3822606 was associated with AD risk.
23695276 we describe for the first time, two patients with MFD and ID and for whom a deletion encompassing TCOF1 and CAMK2A has been identified
23459588 found seven significant associations between CAMK2A SNPs and alcohol dependence, one of which in an autophosphorylation-related area of the gene.
23402759 These results suggest that Osterix is a novel target of CaMKII and the activity of Osterix can be modulated by a novel mechanism involving CaMKII during osteoblast differentiation.
22824813 results suggest that the CAMK2A gene may influence spatial and non-SWM performance in humans without any corresponding gross changes in frontal cortex or hippocampal anatomy.
22815963 Rem2 has a role in neuronal plasticity hrough co-trafficking with CaMKIIa
22573680 Inactivating the alphaCamKII transgene eliminates both the IA-type potassium current-mediated firing decrease and the elevated behavioral response to cocaine.
22505582 The decrease in CaMKII signaling in the absence of CAPN3 is associated with a reduction of muscle adaptation response.
22496345 The role of CaMKII in regulating GLUT4 expression in skeletal muscle.
22427672 Findigs show that the F-actin-binding protein alpha-actinin-2 targets CaMKIIalpha to F-actin in cells by binding to the CaMKII regulatory domain.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22023388 Kv4.3 K channels contribute to cell apoptosis and necrosis through activating CaMKII.
21611732 20 single nucleotide polymorphisms had suggestive associations with conduct disorder, nine of which were located in known genes, including CAMK2A
21610080 Characterization of a central Ca2+/calmodulin-dependent protein kinase IIalpha/beta binding domain in densin that selectively modulates glutamate receptor subunit phosphorylation.
21315782 HIV-1 Tat induces upregulation of HDAC2 expression and downregulation of CREB and CaMKIIa expression in human neuroblastoma SK-N-MC cells
21124984 Data show that he calmodulin-CKII peptide system allows the study of photounbinding under different dissociation constants without changing the molecular system.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20053885 Knockdown of spinal CaMKIIalpha attentuates opioid-induced hyperalgesia.
19638347 Data show that data provide a novel mechanism whereby CaMKII may regulate the proteasome in neurons to facilitate remodeling of synaptic connections through protein degradation.
19453375 Phosphorylation or a phosphorylation mimicking mutation on NR2B (NR2B-S1303D) abolishes the Ca(2+)/calmodulin-independent binding whereas it allows the Ca(2+)/calmodulin-dependent binding of alpha-CaMKII in vitro.
19328558 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18803808 Mice heterozygous for a null mutation of the alpha-isoform of calcium/calmodulin-dependent protein kinase II (alpha-CaMKII+/-) have profoundly dysregulated behaviours and impaired neuronal development in the dentate gyrus
18305109 hCaMKIINalpha suppresses tumor growth by inducing cell cycle arrest via p27 stabilization
18227124 These findings revealed that TNF-alpha induced VCAM-1 expression via multiple signaling pathways.
17632540 alpha-CaMKII controls the growth of human osteosarcoma by regulating cell cycle progression
17627985 Skeletal muscle CaMKII kinase isoform expression and serum response factor phosphorylation is higher with endurance-type exercise training, adaptations that are restricted to active muscle.
17603807 Amphetamine sensitization in rats, an animal model of schizophrenia, results in significant increase in CaMKII beta and a nonsignificant increase in CaMKII alpha mRNA.
17221287 To characterize the human alphaCaMKII promoter, a promoter-reporter gene assay using different cell lines, was developed.
17202341 HIV-1 Tat induces upregulation of HDAC2 expression and downregulation of CREB and CaMKIIa expression in human neuroblastoma SK-N-MC cells
16820363 voltage-dependent facilitation of the Ca(v)1.2 channel depends on the phosphorylation of Ser1512/Ser1570 by calmodulin kinase II
16565089 CD44 interaction with LARG and EGFR plays a pivotal role in Rho/Ras co-activation, PLC epsilon-Ca2+ signaling, and Raf/ERK up-regulation required for CaMKII-mediated cytoskeleton function and in head and neck squamous cell carcinoma progression
16557530 EGF has the ability to abrogate the PP2A function in the maintenance of beta1 integrin-mediated cell adhesion by dissociation of PP2A-IQGAP1-CaMKII from beta1 integrin-Rac through activation of CaMKII
16247765 The expression of CaMKIIalpha is significantly elevated in depression (29%), but not in schizophrenia or bipolar disorder, compared to healthy controls.
16247765 The expression of CaMKII alpha was significantly elevated in depression.
16115892 activation of the IKK/NFkappaB signaling cascade by SSTR2 requires a complicated network consisting of Galpha(14), protein kinase C, CamkII, ERK, and c-Src
15866054 novel mechanism for Ca2+-dependent negative-feedback regulation of NR2B-containing NMDARs in a CaMKII activity- and autophosphorylation-dependent manner that may modulate NMDAR-mediated synaptic plasticity
15621017 CaMKII-alpha may be related with beta-amyloid more closely than being involved in tau hyperphosphorylation in Alzheimer's disease
14722083 measured differences in CaMKII binding affinities for CaM play a minor role in the autophosphorylation of the enzyme, largely dictated by autophosphorylation rate for alpha, beta, gamma and delta isoforms
12954639 Calcium/calmodulin-dependent protein kinase II binds to Raf-1 and modulates integrin-stimulated ERK activation
11930170 CaMKII alpha mRNA expression is significantly reduced in the prefrontal cortex of patients with bipolar illness.
11889801 role in cell communication
11867691 HIV-1 Tat induces upregulation of HDAC2 expression and downregulation of CREB and CaMKIIa expression in human neuroblastoma SK-N-MC cells
11814622 the NPY Y(1) receptor induces the expression of CRE containing target genes through the CaM kinase-CREB pathway
11751951 HIV-1 Tat induces upregulation of HDAC2 expression and downregulation of CREB and CaMKIIa expression in human neuroblastoma SK-N-MC cells
11710563 Four distinct isoforms of CAMKII were isolated. Two of them were characterized as CaMKII alpha and beta subunits.CaMKII expression is developmentally regulated in human fetal and adult brain

AA Sequence

MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHP      1 - 70
NIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPEN     71 - 140
LLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGY    141 - 210
PPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASC    211 - 280
MHRQETVDCLKKFNARRKLKGAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEI    281 - 350
IKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH    351 - 420
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH                421 - 478
//

Text Mined References (135)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25815641 2015 CaMKII Phosphorylation of Na(V)1.5: Novel in Vitro Sites Identified by Mass Spectrometry and Reduced S516 Phosphorylation in Human Heart Failure.
25290264 2014 ?CaMKII controls the establishment of cocaine's reinforcing effects in mice and humans.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24855644 2014 Nitric oxide induces Ca2+-independent activity of the Ca2+/calmodulin-dependent protein kinase II (CaMKII).
24614225 2014 CaMKII mediates recruitment and activation of the deubiquitinase CYLD at the postsynaptic density.
24407174 2014 Dephosphorylation of CaMKII at T253 controls the metaphase-anaphase transition.
24384746 Reelin signaling pathway genotypes and Alzheimer disease in a Spanish population.
23805378 2013 CAMKII and calcineurin regulate the lifespan of Caenorhabditis elegans through the FOXO transcription factor DAF-16.
23695276 2014 Large deletions encompassing the TCOF1 and CAMK2A genes are responsible for Treacher Collins syndrome with intellectual disability.
23459588 2013 ?CaMKII autophosphorylation controls the establishment of alcohol drinking behavior.
23402759 2013 Calmodulin-dependent kinase II regulates osteoblast differentiation through regulation of Osterix.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22824813 2013 CAMK2A polymorphisms predict working memory performance in humans.
22815963 2012 Activity-dependent subcellular cotrafficking of the small GTPase Rem2 and Ca2+/CaM-dependent protein kinase II?.
22573680 2012 AMPAR-independent effect of striatal ?CaMKII promotes the sensitization of cocaine reward.
22505582 2012 Impaired calcium calmodulin kinase signaling and muscle adaptation response in the absence of calpain 3.
22496345 2012 The role of CaMKII in regulating GLUT4 expression in skeletal muscle.
22427672 2012 Substrate-selective and calcium-independent activation of CaMKII by ?-actinin.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22023388 2012 Large T-antigen up-regulates Kv4.3 K? channels through Sp1, and Kv4.3 K? channels contribute to cell apoptosis and necrosis through activation of calcium/calmodulin-dependent protein kinase II.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21611732 2011 Association of ADAM10 and CAMK2A polymorphisms with conduct disorder: evidence from family-based studies.
21610080 2011 Characterization of a central Ca2+/calmodulin-dependent protein kinase IIalpha/beta binding domain in densin that selectively modulates glutamate receptor subunit phosphorylation.
21124984 2010 Photounbinding of calmodulin from a family of CaM binding peptides.
20668654 2010 Structure of the CaMKIIdelta/calmodulin complex reveals the molecular mechanism of CaMKII kinase activation.
20584908 2010 Activation of Na+/H+ exchanger NHE3 by angiotensin II is mediated by inositol 1,4,5-triphosphate (IP3) receptor-binding protein released with IP3 (IRBIT) and Ca2+/calmodulin-dependent protein kinase II.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20053885 2010 Ca2+/calmodulin-dependent protein kinase II alpha is required for the initiation and maintenance of opioid-induced hyperalgesia.
19638347 2009 Regulation of the proteasome by neuronal activity and calcium/calmodulin-dependent protein kinase II.
19453375 2009 Phosphorylation status of the NR2B subunit of NMDA receptor regulates its interaction with calcium/calmodulin-dependent protein kinase II.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
18803808 2008 Alpha-CaMKII deficiency causes immature dentate gyrus, a novel candidate endophenotype of psychiatric disorders.
18311135 2008 Motor protein-dependent transport of AMPA receptors into spines during long-term potentiation.
18305109 2008 A novel endogenous human CaMKII inhibitory protein suppresses tumor growth by inducing cell cycle arrest via p27 stabilization.
18227124 2008 Tumor necrosis factor-alpha enhances neutrophil adhesiveness: induction of vascular cell adhesion molecule-1 via activation of Akt and CaM kinase II and modifications of histone acetyltransferase and histone deacetylase 4 in human tracheal smooth muscle cells.
18218981 2008 Ca2+/calmodulin-dependent protein kinase IIdelta and protein kinase D overexpression reinforce the histone deacetylase 5 redistribution in heart failure.
17632540 2007 alpha-CaMKII controls the growth of human osteosarcoma by regulating cell cycle progression.
17627985 2007 Effect of endurance exercise training on Ca2+ calmodulin-dependent protein kinase II expression and signalling in skeletal muscle of humans.
17603807 2007 Amphetamine sensitization elevates CaMKIIbeta mRNA.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17221287 2008 Identification of the RA response element and transcriptional silencer in human alphaCaMKII promoter.
17052756 2007 Bcl10 is phosphorylated on Ser138 by Ca2+/calmodulin-dependent protein kinase II.
16820363 2006 Calmodulin kinase II is involved in voltage-dependent facilitation of the L-type Cav1.2 calcium channel: Identification of the phosphorylation sites.
16565089 2006 Hyaluronan-CD44 interaction with leukemia-associated RhoGEF and epidermal growth factor receptor promotes Rho/Ras co-activation, phospholipase C epsilon-Ca2+ signaling, and cytoskeleton modification in head and neck squamous cell carcinoma cells.
16557530 2006 Regulation of protein phosphatase 2A-mediated recruitment of IQGAP1 to beta1 integrin by EGF through activation of Ca2+/calmodulin-dependent protein kinase II.
16436603 2006 Transition from reversible to persistent binding of CaMKII to postsynaptic sites and NR2B.
16247765 2006 Increased expression of calcium/calmodulin-dependent protein kinase IIbeta in frontal cortex in schizophrenia and depression.
16120608 2005 Multivalent interactions of calcium/calmodulin-dependent protein kinase II with the postsynaptic density proteins NR2B, densin-180, and alpha-actinin-2.
16115892 2005 Activation of nuclear factor {kappa}B by somatostatin type 2 receptor in pancreatic acinar AR42J cells involves G{alpha}14 and multiple signaling components: a mechanism requiring protein kinase C, calmodulin-dependent kinase II, ERK, and c-Src.
15866054 2005 CaMKIIalpha enhances the desensitization of NR2B-containing NMDA receptors by an autophosphorylation-dependent mechanism.
15673434 2005 A novel scaffold protein, TANC, possibly a rat homolog of Drosophila rolling pebbles (rols), forms a multiprotein complex with various postsynaptic density proteins.
15621017 2005 The expression of calcium/calmodulin-dependent protein kinase II-alpha in the hippocampus of patients with Alzheimer's disease and its links with AD-related pathology.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15358237 2004 Identification of novel phosphorylation sites on postsynaptic density proteins.
15312654 2004 SynGAP-MUPP1-CaMKII synaptic complexes regulate p38 MAP kinase activity and NMDA receptor-dependent synaptic AMPA receptor potentiation.
15140879 2004 Regulation of the multifunctional Ca2+/calmodulin-dependent protein kinase II by the PP2C phosphatase PPM1F in fibroblasts.
15044063 2004 PSD-95 promotes CaMKII-catalyzed serine phosphorylation of the synaptic RAS-GTPase activating protein SynGAP after transient brain ischemia in rat hippocampus.
14970204 2004 Regulation of the neuron-specific Ras GTPase-activating protein, synGAP, by Ca2+/calmodulin-dependent protein kinase II.
14722083 2004 Comparative analyses of the three-dimensional structures and enzymatic properties of alpha, beta, gamma and delta isoforms of Ca2+-calmodulin-dependent protein kinase II.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
14622581 2003 The NMDA receptor is coupled to the ERK pathway by a direct interaction between NR2B and RasGRF1.
12954639 2003 Calcium/calmodulin-dependent protein kinase II binds to Raf-1 and modulates integrin-stimulated ERK activation.
12951199 2003 Cerebral ischemia immediately increases serine phosphorylation of the synaptic RAS-GTPase activating protein SynGAP by calcium/calmodulin-dependent protein kinase II alpha in hippocampus of rats.
12933808 2003 CaMKII-dependent phosphorylation regulates SAP97/NR2A interaction.
12815021 2003 Activation of peripheral NMDA receptors contributes to human pain and rat afferent discharges evoked by injection of glutamate into the masseter muscle.
12630910 2003 Post-synaptic density-95 promotes calcium/calmodulin-dependent protein kinase II-mediated Ser847 phosphorylation of neuronal nitric oxide synthase.
12486117 2003 Phosphorylation of 69-kDa choline acetyltransferase at threonine 456 in response to amyloid-beta peptide 1-42.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475968 2002 Calcium regulation of GM-CSF by calmodulin-dependent kinase II phosphorylation of Ets1.
12435421 2002 Aberrant glycosylation modulates phosphorylation of tau by protein kinase A and dephosphorylation of tau by protein phosphatase 2A and 5.
12408851 2002 Inhibitory autophosphorylation of CaMKII controls PSD association, plasticity, and learning.
12387894 2002 Involvement of aberrant glycosylation in phosphorylation of tau by cdk5 and GSK-3beta.
12223541 2002 The cyclin-dependent kinase 5 activators p35 and p39 interact with the alpha-subunit of Ca2+/calmodulin-dependent protein kinase II and alpha-actinin-1 in a calcium-dependent manner.
12147342 2002 Sequence determinants on the NR2A and NR2B subunits of NMDA receptor responsible for specificity of phosphorylation by CaMKII.
11889801 2002 [Molecular mechanisms of the intracellular localizations of Ca2+/calmodulin-dependent protein kinase II isoforms, and their physiological functions].
11867691 2002 Beta(3)-mediated engulfment of apoptotic tumor cells by dendritic cells is dependent on CAMKII: inhibition by HIV-1 Tat.
11814622 2002 Predominant role by CaM kinase in NPY Y(1) receptor signaling: involvement of CREB [corrected].
11751951 2002 NK cell activation by dendritic cells is dependent on LFA-1-mediated induction of calcium-calmodulin kinase II: inhibition by HIV-1 Tat C-terminal domain.
11710563 2001 Molecular cloning and sequence analyses of calcium/calmodulin-dependent protein kinase II from fetal and adult human brain. Sequence analyses of human brain calciuum/calmodulin-dependent protein kinase II.
11468283 2001 Inositol 1,4,5-trisphosphate 3-kinase A associates with F-actin and dendritic spines via its N terminus.
11459059 2001 Interaction with the NMDA receptor locks CaMKII in an active conformation.
11447121 2001 Phosphorylation of serine 230 promotes inducible transcriptional activity of heat shock factor 1.
11331285 2001 Modulation of the G protein regulator phosducin by Ca2+/calmodulin-dependent protein kinase II phosphorylation and 14-3-3 protein binding.
11306676 2001 Evidence for direct protein kinase-C mediated modulation of N-methyl-D-aspartate receptor current.
11278737 2001 Characterization of a novel synGAP isoform, synGAP-beta.
11264466 2001 Ca(2+)/CaM-dependent kinases: from activation to function.
11222640 2001 Hippocampal synaptic plasticity involves competition between Ca2+/calmodulin-dependent protein kinase II and postsynaptic density 95 for binding to the NR2A subunit of the NMDA receptor.
11160423 2001 Densin-180 forms a ternary complex with the (alpha)-subunit of Ca2+/calmodulin-dependent protein kinase II and (alpha)-actinin.
11104776 2001 Protein kinase C activation modulates alpha-calmodulin kinase II binding to NR2A subunit of N-methyl-D-aspartate receptor complex.
11027280 2000 Inactivation of smad-transforming growth factor beta signaling by Ca(2+)-calmodulin-dependent protein kinase II.
11013247 2001 Calmodulin kinase II attenuation of gene transcription by preventing cAMP response element-binding protein (CREB) dimerization and binding of the CREB-binding protein.
10874031 2000 Inhibition of neuronal nitric-oxide synthase by calcium/ calmodulin-dependent protein kinase IIalpha through Ser847 phosphorylation in NG108-15 neuronal cells.
10862698 2000 Proteomic analysis of NMDA receptor-adhesion protein signaling complexes.
10861222 2000 Expression, purification and characterization of recombinant human choline acetyltransferase: phosphorylation of the enzyme regulates catalytic activity.
10851169 2000 CaM-kinases: modulators of synaptic plasticity.
10753652 2000 Skeletal muscle CaMKII enriches in nuclei and phosphorylates myogenic factor SRF at multiple sites.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10737616 2000 Phosphorylation sites on tau identified by nanoelectrospray mass spectrometry: differences in vitro between the mitogen-activated protein kinases ERK2, c-Jun N-terminal kinase and P38, and glycogen synthase kinase-3beta.
10629061 2000 Death-associated protein kinase-related protein 1, a novel serine/threonine kinase involved in apoptosis.
10400690 1999 Regulation of neuronal nitric-oxide synthase by calmodulin kinases.
10373510 1999 Ras-specific exchange factor GRF: oligomerization through its Dbl homology domain and calcium-dependent activation of Raf.
10347170 1999 Ca2+/calmodulin-dependent kinase II phosphorylates the epidermal growth factor receptor on multiple sites in the cytoplasmic tail and serine 744 within the kinase domain to regulate signal generation.
10318869 1999 MAPKAP kinase 2 phosphorylates serum response factor in vitro and in vivo.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10090741 1999 Phosphorylation that detaches tau protein from microtubules (Ser262, Ser214) also protects it against aggregation into Alzheimer paired helical filaments.
9832145 1998 New phosphorylation sites identified in hyperphosphorylated tau (paired helical filament-tau) from Alzheimer's disease brain using nanoelectrospray mass spectrometry.
9771888 1998 Tau is phosphorylated by GSK-3 at several sites found in Alzheimer disease and its biological activity markedly inhibited only after it is prephosphorylated by A-kinase.
9735171 1998 Phosphorylation of tau at both Thr 231 and Ser 262 is required for maximal inhibition of its binding to microtubules.
9724800 1998 Characterization of a calmodulin kinase II inhibitor protein in brain.
9481670 1998 Adjacent asparagines in the NR2-subunit of the NMDA receptor channel control the voltage-dependent block by extracellular Mg2+.
9452388 1998 Autophosphorylation at Thr286 of the alpha calcium-calmodulin kinase II in LTP and learning.
9452387 1998 Abnormal hippocampal spatial representations in alphaCaMKIIT286A and CREBalphaDelta- mice.
9115241 1997 Rad and Rad-related GTPases interact with calmodulin and calmodulin-dependent protein kinase II.
9099667 1997 Phosphorylation of glial fibrillary acidic protein at the same sites by cleavage furrow kinase and Rho-associated kinase.
8999860 1997 The regulatory Ser262 of microtubule-associated protein tau is phosphorylated by phosphorylase kinase.
8980240 1996 Mice expressing activated CaMKII lack low frequency LTP and do not form stable place cells in the CA1 region of the hippocampus.
8940188 1996 Identification of a phosphorylation site for calcium/calmodulindependent protein kinase II in the NR2B subunit of the N-methyl-D-aspartate receptor.
8665664 1995 Developmental rearrangements of cortical glutamate-NMDA receptor binding sites in late human gestation.
8615909 1996 Expression of Ca2+/calmodulin-dependent protein kinase types II and IV, and reduced DNA synthesis due to the Ca2+/calmodulin-dependent protein kinase inhibitor KN-62 (1-[N,O-bis(5-isoquinolinesulfonyl)-N-methyl-L-tyrosyl]-4-phenyl piperazine) in small cell lung carcinoma.
8413226 1993 A growth factor-induced kinase phosphorylates the serum response factor at a site that regulates its DNA-binding activity.
7929371 1994 Identification of Ser38 as the site in cardiac sarcoplasmic reticulum Ca(2+)-ATPase that is phosphorylated by Ca2+/calmodulin-dependent protein kinase.
7822264 1994 Identification of phosphorylation sites on glial fibrillary acidic protein for cdc2 kinase and Ca(2+)-calmodulin-dependent protein kinase II.
7706316 1995 Microtubule-associated protein/microtubule affinity-regulating kinase (p110mark). A novel protein kinase that regulates tau-microtubule interactions and dynamic instability by phosphorylation at the Alzheimer-specific site serine 262.
7523419 1994 Identification of the major physiologic phosphorylation site of human keratin 18: potential kinases and a role in filament reorganization.
3475713 1987 Molecular cloning of a brain-specific calcium/calmodulin-dependent protein kinase.
2394752 1990 Protein kinase A phosphorylates retinal phosducin on serine 73 in situ.
2164678 1990 Ca2+/calmodulin-dependent protein kinase II: localization in the interphase nucleus and the mitotic apparatus of mammalian cells.
2155236 1990 Phosphorylation sites linked to glial filament disassembly in vitro locate in a non-alpha-helical head domain.
2114109 1990 Ca2(+)-calmodulin-dependent protein kinase II phosphorylates various types of non-epithelial intermediate filament proteins.
1375933 1992 Nitric oxide synthase regulatory sites. Phosphorylation by cyclic AMP-dependent protein kinase, protein kinase C, and calcium/calmodulin protein kinase; identification of flavin and calmodulin binding sites.
1374067 1992 PKC epsilon-related kinase associates with and phosphorylates cytokeratin 8 and 18.
1314426 1992 Calcium-regulated phosphorylation within the leucine zipper of C/EBP beta.
1309762 1992 Mechanism of desensitization of the epidermal growth factor receptor protein-tyrosine kinase.