Property Summary

NCBI Gene PubMed Count 49
PubMed Score 12.55
PubTator Score 15.45

Knowledge Summary

Patent (3,280)

Expression

  Differential Expression (24)

Disease log2 FC p
interstitial lung disease 1.300 9.4e-03
malignant mesothelioma -1.100 2.6e-04
astrocytic glioma -1.900 2.8e-03
ependymoma -2.500 3.5e-03
oligodendroglioma -1.700 1.2e-17
glioblastoma -2.500 2.3e-06
osteosarcoma -1.853 4.8e-04
medulloblastoma -1.900 5.8e-04
atypical teratoid / rhabdoid tumor -2.600 4.0e-06
medulloblastoma, large-cell -2.800 1.8e-03
primitive neuroectodermal tumor -2.000 1.8e-04
pancreatic ductal adenocarcinoma liver m... -1.497 5.6e-03
intraductal papillary-mucinous adenoma (... -2.600 6.9e-04
intraductal papillary-mucinous carcinoma... -3.400 1.0e-05
intraductal papillary-mucinous neoplasm ... -2.700 8.4e-04
cystic fibrosis -1.200 2.8e-04
adult high grade glioma -2.300 1.0e-05
pilocytic astrocytoma -1.600 1.2e-06
subependymal giant cell astrocytoma -2.289 1.7e-02
lung carcinoma 1.600 6.7e-16
Pick disease -1.300 1.5e-02
progressive supranuclear palsy 1.200 1.2e-02
ulcerative colitis -1.800 8.7e-03
ovarian cancer 1.800 6.8e-05

Protein-protein Interaction (10)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (30)

PMID Text
25410890 identified the CAMK1D gene as a novel locus associated with blood pressure response to losartan
23840313 Substantiation of the roles of CAMK1D and CDKAL1 in gluconeogenic and glyconeogenic pathways in primary human hepatocytes.
22923468 Association to type 2 diabetes was found for rs13266634 (SLC30A8), rs7923837 (HHEX), rs10811661 (CDKN2A/2B), rs4402960 (IGF2BP2), rs12779790 (CDC123/CAMK1D), and rs2237892 (KCNQ1).
21909839 A significant association of rs10906115 in CDC123/CAMK1D and rs1359790 near SPRY2 was identified with type 2 diabetes in a Japanese population.
20927120 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20879858 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20418484 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20161779 Observational study of gene-disease association. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
19933996 Observational study of gene-disease association. (HuGE Navigator)
19833888 Observational study of gene-disease association. (HuGE Navigator)
19794065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19741467 Observational study of gene-disease association. (HuGE Navigator)
19720844 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19670153 Observational study of gene-disease association. (HuGE Navigator)
19602701 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
19383354 CAMK1D as a novel amplified oncogene linked to epithelial-mesenchymal transition in breast cancer, with elevated expression in invasive carcinomas compared to carcinoma in situ
19324937 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19139842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19020324 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19020323 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18976975 Knockdown of calcium/calmodulin-dependent protein kinase ID (CAMK1D) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18372903 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
15840691 role of CKLiK in specific granulocyte effector functions such as phagocytosis, respiratory burst, migration, and adhesion

AA Sequence

MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEI      1 - 70
AVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGI     71 - 140
VHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVI    141 - 210
AYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIA    211 - 280
GDTALNKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAP    281 - 350
STLCSFISSSSGVSGVGAERRPRPTTVTAVHSGSK                                       351 - 385
//

Text Mined References (54)

PMID Year Title
25410890 2014 Genome-wide association study identifies CAMKID variants involved in blood pressure response to losartan: the SOPHIA study.
25366777 2014 Analysis of protein-protein interaction network in chronic obstructive pulmonary disease.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25009623 2014 Investigation into the promoter DNA methylation of three genes (CAMK1D, CRY2 and CALM2) in the peripheral blood of patients with type 2 diabetes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23840313 2013 RNAi screening in primary human hepatocytes of genes implicated in genome-wide association studies for roles in type 2 diabetes identifies roles for CAMK1D and CDKAL1, among others, in hepatic glucose regulation.
23568457 2013 Genetic variants associated with disordered eating.
23459443 2014 Drug-gene interactions and the search for missing heritability: a cross-sectional pharmacogenomics study of the QT interval.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22923468 2012 Contribution of common genetic variation to the risk of type 2 diabetes in the Mexican Mestizo population.
21909839 2011 Genetic variants at CDC123/CAMK1D and SPRY2 are associated with susceptibility to type 2 diabetes in the Japanese population.
20927120 2010 Variations in/nearby genes coding for JAZF1, TSPAN8/LGR5 and HHEX-IDE and risk of type 2 diabetes in Han Chinese.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20879858 2010 Impact of single nucleotide polymorphisms and of clinical risk factors on new?onset diabetes mellitus in HIV?infected individuals.
20862305 2010 Identification of new genetic risk variants for type 2 diabetes.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20418484 2010 Common variants associated with breast cancer in genome-wide association studies are modifiers of breast cancer risk in BRCA1 and BRCA2 mutation carriers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20161779 2010 Investigation of type 2 diabetes risk alleles support CDKN2A/B, CDKAL1, and TCF7L2 as susceptibility genes in a Han Chinese cohort.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
19933996 2010 Examination of all type 2 diabetes GWAS loci reveals HHEX-IDE as a locus influencing pediatric BMI.
19833888 2010 Gene variants in the novel type 2 diabetes loci CDC123/CAMK1D, THADA, ADAMTS9, BCL11A, and MTNR1B affect different aspects of pancreatic beta-cell function.
19794065 2010 Polygenic risk variants for type 2 diabetes susceptibility modify age at diagnosis in monogenic HNF1A diabetes.
19741467 2009 Association of common type 2 diabetes risk gene variants and posttransplantation diabetes mellitus in renal allograft recipients in Korea.
19720844 2009 Use of multiple metabolic and genetic markers to improve the prediction of type 2 diabetes: the EPIC-Potsdam Study.
19670153 2010 Lack of significant effects of the type 2 diabetes susceptibility loci JAZF1, CDC123/CAMK1D, NOTCH2, ADAMTS9, THADA, and TSPAN8/LGR5 on diabetes and quantitative metabolic traits.
19602701 2009 Underlying genetic models of inheritance in established type 2 diabetes associations.
19383354 2008 CAMK1D amplification implicated in epithelial-mesenchymal transition in basal-like breast cancer.
19324937 2009 Previously associated type 2 diabetes variants may interact with physical activity to modify the risk of impaired glucose regulation and type 2 diabetes: a study of 16,003 Swedish adults.
19139842 2009 Risk prediction of prevalent diabetes in a Swiss population using a weighted genetic score--the CoLaus Study.
19020324 2008 Clinical risk factors, DNA variants, and the development of type 2 diabetes.
19020323 2008 Genotype score in addition to common risk factors for prediction of type 2 diabetes.
18817731 2008 Calmodulin-kinases: modulators of neuronal development and plasticity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18372903 2008 Meta-analysis of genome-wide association data and large-scale replication identifies additional susceptibility loci for type 2 diabetes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17056143 2007 Spatiotemporal expression of four isoforms of Ca2+/calmodulin-dependent protein kinase I in brain and its possible roles in hippocampal dendritic growth.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16324104 2005 Prominent expression and activity-dependent nuclear translocation of Ca2+/calmodulin-dependent protein kinase Idelta in hippocampal neurons.
15840691 2005 Characterization of the role of CaMKI-like kinase (CKLiK) in human granulocyte function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12935886 2003 Identification and characterization of novel components of a Ca2+/calmodulin-dependent protein kinase cascade in HeLa cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11264466 2001 Ca(2+)/CaM-dependent kinases: from activation to function.
11050006 2000 Identification and characterization of CKLiK, a novel granulocyte Ca(++)/calmodulin-dependent kinase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.