Property Summary

NCBI Gene PubMed Count 45
PubMed Score 42.67
PubTator Score 56.29

Knowledge Summary

Patent (5,823)

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis -1.300 2.8e-02
astrocytic glioma -1.200 4.4e-03
posterior fossa group B ependymoma -2.100 1.5e-10
medulloblastoma -1.700 6.0e-06
atypical teratoid / rhabdoid tumor -1.400 1.4e-04
medulloblastoma, large-cell -2.200 2.4e-04
primitive neuroectodermal tumor -1.300 2.9e-02
adrenocortical carcinoma -1.901 1.7e-03
tuberculosis 1.900 8.3e-09
adult high grade glioma -1.600 3.0e-04
ductal carcinoma in situ -1.300 4.9e-04
invasive ductal carcinoma -1.500 2.2e-03

 GO Component (2)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (20)

PMID Text
26466644 Barettin has inhibitory activity against two protein kinases related to inflammation, namely the receptor-interacting serine/threonine kinase 2 (RIPK2) and calcium/calmodulin-dependent protein kinase 1alpha (CAMK1alpha).
24841198 this study suggests that the tightly linked regulatory loop comprised of the SIK2-PP2A and CaMKI and PME-1 networks may function in fine-tuning cell proliferation and stress response.
24825433 CAMK1 functional regulation subnetwork in hepatocellular carcinoma
24461366 It is one of Ca(2+)-sensing proteins and substantial age- and Alzheimer disease(AD)-related alterations in Ca(2+)-sensing proteins most likely contribute to selective vulnerability of basal forebrain cholinergic neurons to degeneration in AD.
23707388 Fbxl12-induced CaMKI degradation attenuates p27 phosphorylation at these sites in early G1 and iii) activation of CaMKI during G1 transition followed by p27 phosphorylation appears to be upstream to other p27 phosphorylation events
23028635 structures of three CaMKIalpha truncates in apo form and in complexes with ATP
21249615 CaMKI was significantly upregulated in adrenal adenomas.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20433920 HIV-1 gp120-induced neuron death is inhibited by CCL3L1 treatment via the phosphorylation of CREB, the upregulation of Bcl-2, and the PKA and CaMKI/CaMKIV cell signaling pathways
19913121 Observational study of gene-disease association. (HuGE Navigator)
19844571 variants in doublecortin- and calmodulin kinase like 1, a gene up-regulated by BDNF, have roles in memory and general cognitive abilities
19100722 HIV-1 gp120-induced neuron death is inhibited by CCL3L1 treatment via the phosphorylation of CREB, the upregulation of Bcl-2, and the PKA and CaMKI/CaMKIV cell signaling pathways
19086053 Observational study of gene-disease association. (HuGE Navigator)
18089838 Dioxin-mediated up-regulation of aryl hydrocarbon receptor target genes is dependent on the calcium/calmodulin/CaMKIalpha pathway.
15251453 Calcium/calmodulin-dependent protein kinase I inhibits neuronal nitric-oxide synthase activity through serine 741 phosphorylation
14754892 calcium/calmodulin-dependent protein kinase I regulates of cyclin D1/Cdk4 complexes
12935886 we cloned a novel calmodulin-kinase (CaM-KIdelta) from HeLa cells and characterized its activation mechanism. CaM-KIdelta exhibits Ca(2+)/CaM-dependent activity that is enhanced in vitro by phosphorylation of its Thr180 by CaM-K kinase (CaM-KK)alpha
12539042 HIV-1 gp120-induced neuron death is inhibited by CCL3L1 treatment via the phosphorylation of CREB, the upregulation of Bcl-2, and the PKA and CaMKI/CaMKIV cell signaling pathways
12193581 CaMKI is involved in angiotensin II and K(+) stimulation of CYP11B2 transcription and the capacity of the adrenal to produce aldosterone

AA Sequence

MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVL      1 - 70
HKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHR     71 - 140
DLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYI    141 - 210
LLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDT    211 - 280
ALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCC    281 - 350
CRDCCVEPGTELSPTLPHQL                                                      351 - 370
//

Text Mined References (54)

PMID Year Title
26466644 2015 The immunomodulatory effects of barettin and involvement of the kinases CAMK1? and RIPK2.
24841198 2014 Interaction between salt-inducible kinase 2 and protein phosphatase 2A regulates the activity of calcium/calmodulin-dependent protein kinase I and protein phosphatase methylesterase-1.
24825433 2014 CAMK1 phosphoinositide signal-mediated protein sorting and transport network in human hepatocellular carcinoma (HCC) by biocomputation.
24461366 2014 Alterations of Ca²?-responsive proteins within cholinergic neurons in aging and Alzheimer's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23867755 2013 Involvement of Epac1/Rap1/CaMKI/HDAC5 signaling cascade in the regulation of placental cell fusion.
23707388 2013 Fbxl12 triggers G1 arrest by mediating degradation of calmodulin kinase I.
23028635 2012 Crystal structures of human CaMKI? reveal insights into the regulation mechanism of CaMKI.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21301225 2011 Controlling the cell cycle: the role of calcium/calmodulin-stimulated protein kinases I and II.
21269460 2011 Initial characterization of the human central proteome.
21249615 2011 Aldosterone producing adrenal adenomas are characterized by activation of calcium/calmodulin-dependent protein kinase (CaMK) dependent pathways.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20181577 2010 CaMKK-CaMKI signaling pathways differentially control axon and dendrite elongation in cortical neurons.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19844571 2009 Variants in doublecortin- and calmodulin kinase like 1, a gene up-regulated by BDNF, are associated with memory and general cognitive abilities.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18817731 2008 Calmodulin-kinases: modulators of neuronal development and plasticity.
18184567 2008 Activity-dependent synaptogenesis: regulation by a CaM-kinase kinase/CaM-kinase I/betaPIX signaling complex.
18089838 2008 Dioxin-mediated up-regulation of aryl hydrocarbon receptor target genes is dependent on the calcium/calmodulin/CaMKIalpha pathway.
17442826 2007 A calcium- and calmodulin-dependent kinase Ialpha/microtubule affinity regulating kinase 2 signaling cascade mediates calcium-dependent neurite outgrowth.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17056143 2007 Spatiotemporal expression of four isoforms of Ca2+/calmodulin-dependent protein kinase I in brain and its possible roles in hippocampal dendritic growth.
15680915 2005 Identification of major Ca(2+)/calmodulin-dependent protein kinase phosphatase-binding proteins in brain: biochemical analysis of the interaction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15367659 2004 Protein kinases C and D mediate agonist-dependent cardiac hypertrophy through nuclear export of histone deacetylase 5.
15251453 2004 Calcium/calmodulin-dependent protein kinase I inhibits neuronal nitric-oxide synthase activity through serine 741 phosphorylation.
14754892 2004 Regulation of cyclin D1/Cdk4 complexes by calcium/calmodulin-dependent protein kinase I.
14507913 2003 Phosphorylation screening identifies translational initiation factor 4GII as an intracellular target of Ca(2+)/calmodulin-dependent protein kinase I.
12935886 2003 Identification and characterization of novel components of a Ca2+/calmodulin-dependent protein kinase cascade in HeLa cells.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12630910 2003 Post-synaptic density-95 promotes calcium/calmodulin-dependent protein kinase II-mediated Ser847 phosphorylation of neuronal nitric oxide synthase.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475216 2002 Structure of the complex of calmodulin with the target sequence of calmodulin-dependent protein kinase I: studies of the kinase activation mechanism.
12237306 2002 Synapsin I is phosphorylated at Ser603 by p21-activated kinases (PAKs) in vitro and in PC12 cells stimulated with bradykinin.
12193581 2002 Calmodulin-dependent kinase I regulates adrenal cell expression of aldosterone synthase.
11749376 2001 Structure and regulation of calcium/calmodulin-dependent protein kinases.
11395482 2001 Human Ca2+/calmodulin-dependent protein kinase kinase beta gene encodes multiple isoforms that display distinct kinase activity.
11114197 2000 Activation of the myocyte enhancer factor-2 transcription factor by calcium/calmodulin-dependent protein kinase-stimulated binding of 14-3-3 to histone deacetylase 5.
11081517 2000 Signal-dependent nuclear export of a histone deacetylase regulates muscle differentiation.
10874031 2000 Inhibition of neuronal nitric-oxide synthase by calcium/ calmodulin-dependent protein kinase IIalpha through Ser847 phosphorylation in NG108-15 neuronal cells.
10571231 1999 A phospho-switch controls the dynamic association of synapsins with synaptic vesicles.
10400690 1999 Regulation of neuronal nitric-oxide synthase by calmodulin kinases.
10187789 1999 Inhibition of the Ca2+/calmodulin-dependent protein kinase I cascade by cAMP-dependent protein kinase.
9822657 1998 Components of a calmodulin-dependent protein kinase cascade. Molecular cloning, functional characterization and cellular localization of Ca2+/calmodulin-dependent protein kinase kinase beta.
9705275 1998 Characterization of the mechanism of regulation of Ca2+/ calmodulin-dependent protein kinase I by calmodulin and by Ca2+/calmodulin-dependent protein kinase kinase.
9662074 1998 Cloning, expression and chromosomal localization of human Ca2+/calmodulin-dependent protein kinase kinase.
9395448 1997 Characterization of substrate phosphorylation and use of calmodulin mutants to address implications from the enzyme crystal structure of calmodulin-dependent protein kinase I.
8384217 1993 Activating transcription factor-1 can mediate Ca(2+)- and cAMP-inducible transcriptional activation.
7641687 1995 Human calcium-calmodulin dependent protein kinase I: cDNA cloning, domain structure and activation by phosphorylation at threonine-177 by calcium-calmodulin dependent protein kinase I kinase.
7559563 1995 The regulatory region of calcium/calmodulin-dependent protein kinase I contains closely associated autoinhibitory and calmodulin-binding domains.
1375933 1992 Nitric oxide synthase regulatory sites. Phosphorylation by cyclic AMP-dependent protein kinase, protein kinase C, and calcium/calmodulin protein kinase; identification of flavin and calmodulin binding sites.