Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.50
PubTator Score 10.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.500 9.8e-03
glioblastoma -4.400 8.7e-05
oligodendroglioma -1.900 2.4e-06
ependymoma -5.000 2.3e-21
group 3 medulloblastoma -4.700 4.5e-06
atypical teratoid / rhabdoid tumor -3.700 4.0e-04
medulloblastoma, large-cell -3.900 4.6e-04
primitive neuroectodermal tumor -3.200 6.5e-03
adult high grade glioma -4.700 1.5e-07
pilocytic astrocytoma -3.800 1.6e-06
aldosterone-producing adenoma 1.106 3.6e-02
subependymal giant cell astrocytoma -5.385 2.9e-03
ovarian cancer 1.400 9.0e-09

Gene RIF (5)

PMID Text
26206863 detected the first genome-wide significant association of schizophrenia with CALN1, which is a predicted target of MIR137, and thus provide new evidence for the associations between MIR137 targets and schizophrenia
26163462 provide strong evidence that CALN1 is a target of miR-137.
26116628 The protein is most abundant in Purkinje cells of the cerebellum and principal neurons of the cortex and limbic brain whereas no expression in glial cells is apparent.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19338761 CaBP7 and 8 possess a targeting mechanism that is unique amongst the CaBPs that may contribute to differential functional Ca(2+)-sensing by these family members.

AA Sequence

MPFHHVTAGLLYKGNYLNRSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGY      1 - 70
MPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHIL     71 - 140
YHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFAMAFIISVMLIAA    141 - 210
NQILRSGME                                                                 211 - 219
//

Text Mined References (19)

PMID Year Title
26206863 2015 Loci with genome-wide associations with schizophrenia in the Han Chinese population.
26163462 2015 Experimental validation of candidate schizophrenia gene CALN1 as a target for microRNA-137.
26116628 2015 Alternative splicing, expression and cellular localization of Calneuron-1 in the rat and human brain.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19338761 2009 Membrane targeting of the EF-hand containing calcium-sensing proteins CaBP7 and CaBP8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11286509 2001 Identification of a human brain-specific gene, calneuron 1, a new member of the calmodulin superfamily.
9847074 1998 Toward a complete human genome sequence.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.