Property Summary

Ligand Count 1
NCBI Gene PubMed Count 137
PubMed Score 5859.51
PubTator Score 609.98

Knowledge Summary

Patent

No data available

Expression

Gene RIF (34)

AA Sequence

MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL      1 - 70
TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE     71 - 140
EFVQMMTAK                                                                 141 - 149
//

Text Mined References (153)

PMID Year Title