Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.70
PubTator Score 1.23

Knowledge Summary

Patent (700)

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 2.400 3.3e-07
psoriasis 1.500 4.3e-04
osteosarcoma 1.523 1.1e-03
cystic fibrosis -1.087 9.3e-05
non-small cell lung cancer -1.139 1.0e-16
intraductal papillary-mucinous adenoma (... -1.200 4.6e-04
ovarian cancer -1.400 7.4e-07
pituitary cancer 1.100 3.8e-04

Synonym

Accession Q9HA72 D3DR94 O95893 Q6ZUV9
Symbols FAM26B

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (1)

Jing-Ruey Yeh 64 gRNA validated for zebrafish model, zebrafish mutant available

Gene RIF (3)

PMID Text
20164573 This study failed to show an association between theeight SNPs of the CALHM2 genes and alzheimer disease.
20164573 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAALIAENFRFLSLFFKSKDVMIFNGLVALGTVGSQELFSVVAFHCPCSPARNYLYGLAAIGVPALVLFI      1 - 70
IGIILNNHTWNLVAECQHRRTKNCSAAPTFLLLSSILGRAAVAPVTWSVISLLRGEAYVCALSEFVDPSS     71 - 140
LTAREEHFPSAHATEILARFPCKENPDNLSDFREEVSRRLRYESQLFGWLLIGVVAILVFLTKCLKHYCS    141 - 210
PLSYRQEAYWAQYRANEDQLFQRTAEVHSRVLAANNVRRFFGFVALNKDDEELIANFPVEGTQPRPQWNA    211 - 280
ITGVYLYRENQGLPLYSRLHKWAQGLAGNGAAPDNVEMALLPS                               281 - 323
//

Text Mined References (11)

PMID Year Title
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
20164573 2010 Genetic association between CALHM1, 2, and 3 polymorphisms and Alzheimer's disease in a Japanese population.
18585350 2008 A polymorphism in CALHM1 influences Ca2+ homeostasis, Abeta levels, and Alzheimer's disease risk.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.