Property Summary

NCBI Gene PubMed Count 57
PubMed Score 801.50
PubTator Score 73.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3098 4.9e-23
ovarian cancer 8491 1.3e-11
juvenile dermatomyositis 1189 3.0e-11
Duchenne muscular dystrophy 602 3.4e-08
posterior fossa group A ependymoma 1511 3.5e-07
malignant mesothelioma 3163 2.7e-06
urothelial carcinoma 318 8.8e-06
medulloblastoma, large-cell 6234 1.1e-05
primitive neuroectodermal tumor 3031 1.4e-05
cystic fibrosis 1670 2.6e-05
nasopharyngeal carcinoma 1056 2.8e-05
primary pancreatic ductal adenocarcinoma 1271 3.7e-05
pediatric high grade glioma 2712 3.9e-05
osteosarcoma 7933 5.9e-05
atypical teratoid / rhabdoid tumor 4369 5.9e-05
Amyotrophic Lateral Sclerosis 432 8.4e-05
pancreatic carcinoma 567 1.4e-04
pancreatic cancer 2300 2.0e-04
sonic hedgehog group medulloblastoma 1482 2.3e-04
lung adenocarcinoma 2714 3.0e-04
glioblastoma 5572 3.1e-04
gastric cancer 436 3.4e-04
colon cancer 1475 5.3e-04
acute quadriplegic myopathy 1157 7.9e-04
psoriasis 6685 9.6e-04
Pick disease 1893 2.6e-03
astrocytic glioma 2241 2.8e-03
oligodendroglioma 2849 2.8e-03
intraductal papillary-mucinous adenoma (IPMA) 2956 3.7e-03
pituitary cancer 1972 4.2e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 499 4.3e-03
ulcerative colitis 2087 4.4e-03
invasive ductal carcinoma 2950 5.0e-03
dermatomyositis 966 7.6e-03
mucosa-associated lymphoid tissue lymphoma 480 7.9e-03
pterygium 74 9.1e-03
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.2e-03
interstitial cystitis 2299 9.5e-03
pilocytic astrocytoma 3086 1.3e-02
adrenocortical carcinoma 1427 1.3e-02
hereditary spastic paraplegia 313 1.4e-02
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.4e-02
hepatocellular carcinoma 550 1.5e-02
interstitial lung disease 292 1.6e-02
subependymal giant cell astrocytoma 2287 3.4e-02
head and neck cancer 270 4.0e-02

Expression

  Differential Expression (46)

Disease log2 FC p
gastric cancer 2.200 3.4e-04
hepatocellular carcinoma 1.300 1.5e-02
pancreatic cancer 3.100 2.0e-04
interstitial lung disease 1.200 1.6e-02
urothelial carcinoma 3.800 8.8e-06
malignant mesothelioma -1.200 2.7e-06
astrocytic glioma 1.700 2.8e-03
posterior fossa group A ependymoma 2.300 3.5e-07
oligodendroglioma 1.500 2.8e-03
psoriasis -2.600 9.6e-04
glioblastoma 2.600 3.1e-04
osteosarcoma 3.314 5.9e-05
sonic hedgehog group medulloblastoma 2.400 2.3e-04
cystic fibrosis -2.618 2.6e-05
atypical teratoid / rhabdoid tumor 2.500 5.9e-05
medulloblastoma, large-cell 2.200 1.1e-05
primitive neuroectodermal tumor 1.500 1.4e-05
Duchenne muscular dystrophy 1.798 3.4e-08
autosomal dominant Emery-Dreifuss muscul... 1.569 4.3e-03
hereditary spastic paraplegia -1.134 1.4e-02
juvenile dermatomyositis 1.631 3.0e-11
Amyotrophic Lateral Sclerosis 1.172 8.4e-05
acute quadriplegic myopathy 1.171 7.9e-04
adrenocortical carcinoma -1.123 1.3e-02
primary pancreatic ductal adenocarcinoma 3.180 3.7e-05
intraductal papillary-mucinous adenoma (... -2.400 3.7e-03
intraductal papillary-mucinous carcinoma... -2.700 9.2e-03
intraductal papillary-mucinous neoplasm ... -2.200 1.4e-02
colon cancer -2.600 5.3e-04
interstitial cystitis 1.100 9.5e-03
pediatric high grade glioma 2.500 3.9e-05
pilocytic astrocytoma 1.300 1.3e-02
pancreatic carcinoma 2.400 1.4e-04
subependymal giant cell astrocytoma 2.223 3.4e-02
lung adenocarcinoma 1.641 3.0e-04
nasopharyngeal carcinoma 1.800 2.8e-05
Pick disease 1.100 2.6e-03
Breast cancer -2.200 4.9e-23
pterygium 1.200 9.1e-03
mucosa-associated lymphoid tissue lympho... 1.528 7.9e-03
invasive ductal carcinoma -1.100 5.0e-03
ulcerative colitis 1.700 4.4e-03
ovarian cancer -3.500 1.3e-11
pituitary cancer -1.600 4.2e-03
dermatomyositis 1.800 7.6e-03
head and neck cancer -1.900 4.0e-02

Protein-protein Interaction (6)

Gene RIF (32)

PMID Text
26430961 Data indicate that low-molecular-weight caldesmon isoforms (L-CAD) promotes migration and invasiveness of urothelial bladder carcinoma (BC) cells.
24551305 Caldesmon and smoothelin staining allows better delineation of the muscularis propria from the desmoplastic stromal reaction which provides a critical aide for proper staging of colonic adenocarcinomas.
23575144 Caldesmon is a possible predictor of endometrial dysregulation in patients with endometriosis.
23418348 The data suggest that PKGIbeta enhances breast cancer cell motility and invasive capacity, at least in part, by phosphorylating CaD.
23265641 Caldesmon expression inhibits cancer cell migration and invasiveness.
23196794 caldesmon is not useful in distinguishing between peritoneal epithelioid mesotheliomas and papillary serous carcinomas involving the peritoneum
22316291 Disruption of the normal inhibitory function of human caldesmon 1 enhances intestinal peristalsis in both wild-type zebrafish larvae and mutant larvae that lack enteric nerves
21738699 Data found phasic phosphorylation of caldesmon and ERK 1/2 during contractions in human myometrium.
21626272 Our results show a differential behavior of h- and l-caldesmon isoforms in epithelium and stroma of colon adenocarcinoma and lymph node metastases.
21184254 Novel biological cascade that involved the phosphorylation activation of CaD by PFTK1 kinase in promoting formation of actin stress fibers.
21131830 h-caldesmon is useful in distinguishing atypical polypoid adenomyoma from myoinvasive endometrioid carcinoma
20801058 An involvement of caldesmon in the susceptibility to diabetic nephropathy in type 1 diabetes, independently from environmental glucose levels.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19889635 The effect of a C-terminal fragment of CaD (H32K) on the kinetics of the in vitro actin polymerization by monitoring the fluorescence of pyrene-labeled actin, was studied.
19834610 Stretch activates myometrium via ERK, caldesmon and focal adhesion signaling
19764806 Results describe the mechanisms of PC6 action in decidualization and identify caldesmon as one of its physiological substrates.
19582387 Vaginal caldesmon expression is significantly decreased in women with anterior vaginal wall prolapse compared to normal subjects
18772142 GR directly bound to the two glucocorticoid-response element-like sequences in the human CALD1 promoter and transactivated the CALD1 gene, thereby up-regulating the CaD protein.
18353764 A subset of the tumor-specific splicing alterations (ACTN1, CALD1, and VCL) was found in all three organs and may represent general cancer-related splicing events.
17631293 Caldesmon suppresses cancer cell invasion by regulating podosome/invadopodium formation.
17582218 low molecular weight isoform CaD undergoes a DNA replication-associated switch in localization from the cytoplasm to the nuclei of endothelial cells/endothelial progenitor cells in human tumor vasculature
16800003 Phosphorylation of caldesmon by PAK is a dynamic process required to regulate actin dynamics and membrane protrusions in wound-induced cell migration.
16115893 K-cyclin expression modulates the activity of caldesmon and through this the microfilament functions in cells
15958622 Serum l-CaD level as determined by ELISA is a good discriminator between glioma patients versus patients with other intracranial tumor.
15521070 These results suggest that CaD is critically involved in the regulation of the actin cytoskeleton and migration in EC, and that p38 MAPK-mediated CaD phosphorylation may be involved in endothelial cytoskeletal remodeling.
15456752 unphosphorylated, but not ERK-phosphorylated, caldesmon could stabilize actin filaments and resist F-actin severing or depolymerization in both smooth muscle and nonmuscle cells
15226374 plays a crucial role in mediating the effects of Ca(2+)-calmodulin on the dynamics of the actin cytoskeleton
15161654 Alternative splicing contributes to dysfunctionality of glioma neovascularization.
15047636 Observational study of gene-disease association. (HuGE Navigator)
15047636 results suggest a role for the caldesmon gene in susceptibility to diabetic nephropathy in type 1 diabetes
11996092 Motifs of the caldesmon family.
11759055 Specific but variable expression of h-caldesmon in leiomyosarcomas

AA Sequence

MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEVNA      1 - 70
QNSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKEFDPTITDASLSLPSRRMQND     71 - 140
TAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDAEENKKEDKEKEEEEEEKPKRGSIGENQVEV    141 - 210
MVEEKTTESQEETVVMSLKNGQISSEEPKQEEEREQGSDEISHHEKMEEEDKERAEAERARLEAEERERI    211 - 280
KAEQDKKIADERARIEAEEKAAAQERERREAEERERMREEEKRAAEERQRIKEEEKRAAEERQRIKEEEK    281 - 350
RAAEERQRIKEEEKRAAEERQRARAEEEEKAKVEEQKRNKQLEEKKHAMQETKIKGEKVEQKIEGKWVNE    351 - 420
KKAQEDKLQTAVLKKQGEEKGTKVQAKREKLQEDKPTFKKEEIKDEKIKKDKEPKEEVKSFMDRKKGFTE    421 - 490
VKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQE    491 - 560
AALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDD    561 - 630
KKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAAS    631 - 700
DLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPG    701 - 770
DVSSKRNLWEKQSVDKVTSPTKV                                                   771 - 793
//

Text Mined References (67)

PMID Year Title
26430961 2015 Overexpression of caldesmon is associated with tumor progression in patients with primary non-muscle-invasive bladder cancer.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24551305 2014 Smoothelin and caldesmon are reliable markers for distinguishing muscularis propria from desmoplasia: a critical distinction for accurate staging colorectal adenocarcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23575144 2013 Caldesmon: new insights for diagnosing endometriosis.
23418348 2013 cGMP-dependent protein kinase I? regulates breast cancer cell migration and invasion via interaction with the actin/myosin-associated protein caldesmon.
23265641 2013 Identification and functional validation of caldesmon as a potential gastric cancer metastasis-associated protein.
23196794 2013 Value of PAX8, PAX2, claudin-4, and h-caldesmon immunostaining in distinguishing peritoneal epithelioid mesotheliomas from serous carcinomas.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22316291 2012 Smooth muscle caldesmon modulates peristalsis in the wild type and non-innervated zebrafish intestine.
21738699 2011 Phasic phosphorylation of caldesmon and ERK 1/2 during contractions in human myometrium.
21626272 2011 Histochemical localization of caldesmon isoforms in colon adenocarcinoma and lymph node metastases.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21184254 2011 Phosphorylation of Caldesmon by PFTAIRE1 kinase promotes actin binding and formation of stress fibers.
21131830 2011 Immunohistochemical characteristics of atypical polypoid adenomyoma with special reference to h-caldesmon.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20801058 Caldesmon over-expression in type 1 diabetic nephropathy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19889635 2010 Differential effects of caldesmon on the intermediate conformational states of polymerizing actin.
19834610 2009 Stretch activates human myometrium via ERK, caldesmon and focal adhesion signaling.
19764806 2009 Proteomic identification of caldesmon as a physiological substrate of proprotein convertase 6 in human uterine decidual cells essential for pregnancy establishment.
19582387 2009 Caldesmon expression is decreased in women with anterior vaginal wall prolapse: a pilot study.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18772142 2008 Glucocorticoid receptor-mediated expression of caldesmon regulates cell migration via the reorganization of the actin cytoskeleton.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18353764 2008 Alternative splicing in colon, bladder, and prostate cancer identified by exon array analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17631293 2007 Caldesmon suppresses cancer cell invasion by regulating podosome/invadopodium formation.
17582218 2007 Hela /-CaD undergoes a DNA replication-associated switch in localization from the cytoplasm to the nuclei of endothelial cells/endothelial progenitor cells in human tumor vasculature.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16800003 2006 Requirement of reversible caldesmon phosphorylation at P21-activated kinase-responsive sites for lamellipodia extensions during cell migration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
16115893 2005 Regulation of microfilament organization by Kaposi sarcoma-associated herpes virus-cyclin.CDK6 phosphorylation of caldesmon.
15958622 2005 Low-molecular weight caldesmon as a potential serum marker for glioma.
15521070 2005 The role of caldesmon in the regulation of endothelial cytoskeleton and migration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456752 2004 Modes of caldesmon binding to actin: sites of caldesmon contact and modulation of interactions by phosphorylation.
15226374 2004 Caldesmon mutant defective in Ca(2+)-calmodulin binding interferes with assembly of stress fibers and affects cell morphology, growth and motility.
15161654 2004 Differential expression of splicing variants of the human caldesmon gene (CALD1) in glioma neovascularization versus normal brain microvasculature.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15047636 2004 Association between variation in the actin-binding gene caldesmon and diabetic nephropathy in type 1 diabetes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14627618 2003 Smooth muscle contraction and relaxation.
12853948 2003 The DNA sequence of human chromosome 7.
12613668 2003 Regulation of caldesmon activity by Cdc2 kinase plays an important role in maintaining membrane cortex integrity during cell division.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11894847 2001 Caldesmon and smooth-muscle regulation.
11759055 2001 Specific but variable expression of h-caldesmon in leiomyosarcomas: an immunohistochemical reassessment of a novel myogenic marker.
11736632 2001 Some properties of caldesmon and calponin and the participation of these proteins in regulation of smooth muscle contraction and cytoskeleton formation.
11098082 2000 Seven genes that are differentially transcribed in colorectal tumor cell lines.
10919986 2000 Prenatal origins of human intrapulmonary arteries: formation and smooth muscle maturation.
10766836 2000 Regulation of microfilament reorganization and invasiveness of breast cancer cells by kinase dead p21-activated kinase-1.
9415999 Caldesmon.
9003189 1997 Tryptophan residues in caldesmon are major determinants for calmodulin binding.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8581978 1995 Over-expression of smooth muscle caldesmon in mouse fibroblasts.
8307018 1994 Purification and characterization of erythrocyte caldesmon. Hypothesis for an actin-linked regulation of a contractile activity in the red blood cell membrane.
8227296 1993 Identification of functioning regulatory sites and a new myosin binding site in the C-terminal 288 amino acids of caldesmon expressed from a human clone.
1885618 1991 Characterization of cDNA clones encoding a human fibroblast caldesmon isoform and analysis of caldesmon expression in normal and transformed cells.
1601129 1992 Phosphorylation sequences in h-caldesmon from phorbol ester-stimulated canine aortas.
1555769 1992 Cloning of cDNAs encoding human caldesmons.
1465449 1992 Genomic structure of the human caldesmon gene.