Property Summary

NCBI Gene PubMed Count 37
PubMed Score 214.91
PubTator Score 25.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 2.0e-08
medulloblastoma, large-cell 6234 1.5e-04
lung cancer 4473 1.3e-03
adult high grade glioma 2148 1.3e-03
Multiple myeloma 1327 3.5e-03
Breast cancer 3098 3.3e-02
Disease Target Count Z-score Confidence
Cancer 2346 3.022 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.059 3.5e-03
medulloblastoma, large-cell 1.300 1.5e-04
lung cancer -2.100 1.3e-03
Breast cancer -1.800 3.3e-02
adult high grade glioma 1.100 1.3e-03
ovarian cancer -1.700 2.0e-08

Gene RIF (20)

PMID Text
26506893 insight into how CALCOCO2 targets ubiquitin-decorated pathogens for autophagic degradations
26493630 Presence of the NDP52 rs2303015 minor variant increases the risk for spontaneous bacterial peritonitis in patients with alcoholic cirrhosis.
26266977 two receptors previously linked to xenophagy, NDP52 and optineurin, are the primary receptors for PINK1- and parkin-mediated mitophagy
25771791 These data show that NDP52 promotes the maturation of autophagosomes via its interaction with LC3A, LC3B, and/or GABARAPL2 through a distinct LC3-interacting region, and with MYOSIN VI.
25366815 control retrotransposon insertion in the genome
25033267 data support a model in which non-ND10 resident Sp100 acts as a negative regulator of polycomb repressive complex-2 (PRC2) recruitment, and suggest that KSHV may actively escape ND10 silencing mechanisms to promote establishment of latent chromatin.
24453968 the role of ORF75 in the antagonization of ND10-mediated intrinsic immunity
23624108 The missense SNP rs2303015 (Val248Ala) in the NDP52 was associated with Crohn's disease.
23511477 Dimeric NDP52 forms a ternary complex with two monomeric galectin-8 molecules as well as two LC3C molecules
23386746 Data indicate that the binding site in galectin-8 is essential for the recruitment of the autophagy receptor NDP52 to cytosol-exposed Salmonella Typhimurium.
23209807 Autophagy of Tax1bp1/Ndp52 promotes non-canonical NF-kappaB signalling.
23143396 Data show that the miRNA-processing enzyme, DICER and the main miRNA effector, AGO2, are targeted for degradation as miRNA-free entities
23022382 Data show that the selectivity of the autophagy receptor NDP52 for LC3C is crucial for innate immunity since cells lacking either protein cannot protect their
21964925 a selective autophagic mechanism mediated by NDP52 that works downstream of TRIF-TRAF6.
21646350 p62 and NDP52 proteins target intracytosolic Shigella and Listeria to different autophagy pathways.
21552525 ND10 and ND10 components might be important defensive factors against the CMV cross-species infection
21079414 p62 and NDP52 act cooperatively to drive efficient antibacterial autophagy by targeting the protein complexes they coordinate to distinct microdomains associated with bacteria
19820708 NDP52 recognizes ubiquitin-coated Salmonella enterica and recruits TBK1.
17635994 NDP52 was identified as a myosin VI binding protein; results suggest that myosin VI-T6BP-NDP52 complexes may play a role in coordinating cytokine signalling and membrane transport pathways with actin filament organisation and cell adhesion
14747555 interacts with ICP4 regulatory protein of HSV-1 during early stage of infection

AA Sequence

MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYY      1 - 70
TFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQG     71 - 140
EVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELL    141 - 210
QLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQK    211 - 280
KLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMG    281 - 350
LDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCF    351 - 420
NCPICDKIFPATEKQIFEDHVFCHSL                                                421 - 446
//

Text Mined References (42)

PMID Year Title
26506893 2015 Molecular basis of ubiquitin recognition by the autophagy receptor CALCOCO2.
26493630 2016 A variant in the nuclear dot protein 52kDa gene increases the risk for spontaneous bacterial peritonitis in patients with alcoholic liver cirrhosis.
26266977 2015 The ubiquitin kinase PINK1 recruits autophagy receptors to induce mitophagy.
25771791 2015 Autophagy receptor NDP52 regulates pathogen-containing autophagosome maturation.
25416956 2014 A proteome-scale map of the human interactome network.
25366815 2014 Autophagy supports genomic stability by degrading retrotransposon RNA.
25033267 2014 Influence of ND10 components on epigenetic determinants of early KSHV latency establishment.
24453968 2014 Kaposi's sarcoma associated herpesvirus tegument protein ORF75 is essential for viral lytic replication and plays a critical role in the antagonization of ND10-instituted intrinsic immunity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23624108 2013 Association between variants of PRDM1 and NDP52 and Crohn's disease, based on exome sequencing and functional studies.
23511477 2013 Structural basis for recognition of autophagic receptor NDP52 by the sugar receptor galectin-8.
23386746 2013 Sterical hindrance promotes selectivity of the autophagy cargo receptor NDP52 for the danger receptor galectin-8 in antibacterial autophagy.
23245322 2012 The LRR and RING domain protein LRSAM1 is an E3 ligase crucial for ubiquitin-dependent autophagy of intracellular Salmonella Typhimurium.
23209807 2012 TBK1 kinase addiction in lung cancer cells is mediated via autophagy of Tax1bp1/Ndp52 and non-canonical NF-?B signalling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23143396 2012 Selective autophagy degrades DICER and AGO2 and regulates miRNA activity.
23022382 2012 LC3C, bound selectively by a noncanonical LIR motif in NDP52, is required for antibacterial autophagy.
22246324 2012 Galectin 8 targets damaged vesicles for autophagy to defend cells against bacterial invasion.
21964925 2012 Regulation of Toll-like receptor signaling by NDP52-mediated selective autophagy is normally inactivated by A20.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21646350 2011 p62 and NDP52 proteins target intracytosolic Shigella and Listeria to different autophagy pathways.
21552525 2011 Functional interaction of nuclear domain 10 and its components with cytomegalovirus after infections: cross-species host cells versus native cells.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21079414 2011 The ubiquitin-binding adaptor proteins p62/SQSTM1 and NDP52 are recruited independently to bacteria-associated microdomains to target Salmonella to the autophagy pathway.
19946888 2010 Defining the membrane proteome of NK cells.
19820708 2009 The TBK1 adaptor and autophagy receptor NDP52 restricts the proliferation of ubiquitin-coated bacteria.
18985028 2008 Hepatitis C virus infection protein network.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17635994 2007 T6BP and NDP52 are myosin VI binding partners with potential roles in cytokine signalling and cell adhesion.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14747555 2004 Formation of nuclear foci of the herpes simplex virus type 1 regulatory protein ICP4 at early times of infection: localization, dynamics, recruitment of ICP27, and evidence for the de novo induction of ND10-like complexes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12869526 2003 HCC-associated protein HCAP1, a variant of GEMIN4, interacts with zinc-finger proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12033769 2002 Reorganization of nuclear domain 10 induced by papillomavirus capsid protein l2.
9230084 1997 Cellular localization, expression, and structure of the nuclear dot protein 52.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7540613 1995 Molecular characterization of NDP52, a novel protein of the nuclear domain 10, which is redistributed upon virus infection and interferon treatment.