Property Summary

NCBI Gene PubMed Count 20
PubMed Score 27.33
PubTator Score 55.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 5.2e-08
juvenile dermatomyositis 1189 1.3e-05
sonic hedgehog group medulloblastoma 1482 2.3e-03
Disease Target Count Z-score Confidence
Thyroid medullary carcinoma 3 3.928 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 2.434 1.3e-05
sonic hedgehog group medulloblastoma 2.900 2.3e-03
psoriasis -1.200 5.2e-08

Gene RIF (4)

PMID Text
21641113 Keratinocyte-derived CGRPbeta may modulate epidermal homeostasis through autocrine/paracrine signaling and may contribute to chronic pain under pathological conditions.
19192276 Calcitonin gene-related peptide stimulates proliferation of alveolar epithelial cells.
19086053 Observational study of gene-disease association. (HuGE Navigator)
15761041 CGRP and ADM are two differentially regulated novel adipose tissue secretion factors exerting autocrine/paracrine roles.

AA Sequence

MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQE      1 - 70
TQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA                  71 - 127
//

Text Mined References (20)

PMID Year Title
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21641113 2011 Keratinocyte expression of calcitonin gene-related peptide ?: implications for neuropathic and inflammatory pain mechanisms.
19192276 2009 Calcitonin gene-related peptide stimulates proliferation of alveolar epithelial cells.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
15761041 2005 Autocrine/paracrine role of inflammation-mediated calcitonin gene-related peptide and adrenomedullin expression in human adipose tissue.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11803621 2001 MRP 8/14 and procalcitonin serum levels in organ transplantations.
8468047 1993 High-resolution chromosomal localization of the human calcitonin/CGRP/IAPP gene family members.
6091915 1984 The human LDL receptor: a cysteine-rich protein with multiple Alu sequences in its mRNA.
3493259 1987 Expression of the second calcitonin/calcitonin gene-related peptide gene in Ewing sarcoma cell lines.
3492492 1987 Identification in the human central nervous system, pituitary, and thyroid of a novel calcitonin gene-related peptide, and partial amino acid sequence in the spinal cord.
3492393 1986 Structure and expression of the human calcitonin/CGRP genes.
2985435 1985 A second human calcitonin/CGRP gene.
2322288 1990 Isolation, purification and characterization of beta-hCGRP from human spinal cord.
1318039 1992 Isolation and characterization of peptides which act on rat platelets, from a pheochromocytoma.