Property Summary

NCBI Gene PubMed Count 21
PubMed Score 27.31
PubTator Score 55.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.2e-08
juvenile dermatomyositis 1187 1.3e-05
sonic hedgehog group medulloblastoma 467 2.3e-03
Disease Target Count Z-score Confidence
Thyroid medullary carcinoma 3 3.926 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 2.434 1.3e-05
psoriasis -1.200 5.2e-08
sonic hedgehog group medulloblastoma 2.900 2.3e-03

Gene RIF (5)

AA Sequence

MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQE      1 - 70
TQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA                  71 - 127
//

Text Mined References (21)

PMID Year Title