Property Summary

NCBI Gene PubMed Count 81
PubMed Score 1330.59
PubTator Score 78.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -5.800 1.4e-09
adult high grade glioma -2.400 2.0e-04
aldosterone-producing adenoma -1.242 2.1e-02
astrocytic glioma -1.300 4.6e-03
Astrocytoma, Pilocytic -1.500 1.3e-03
atypical teratoid/rhabdoid tumor -1.400 8.8e-04
ductal carcinoma in situ -3.200 8.2e-04
ependymoma -1.500 1.4e-03
glioblastoma -2.500 2.2e-09
group 3 medulloblastoma -1.700 2.7e-02
invasive ductal carcinoma -3.900 8.4e-04
oligodendroglioma -1.500 1.3e-02
ovarian cancer -4.500 3.5e-23
primitive neuroectodermal tumor -1.900 4.3e-03

 GO Function (1)

Gene RIF (61)

AA Sequence

MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKE      1 - 70
FMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLL     71 - 140
KKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKD    141 - 210
RSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM             211 - 271
//

Text Mined References (82)

PMID Year Title