Property Summary

NCBI Gene PubMed Count 43
PubMed Score 2070.55
PubTator Score 153.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 6.800 5.1e-08
astrocytic glioma -3.000 1.7e-02
ependymoma -4.200 1.7e-03
oligodendroglioma -4.000 1.2e-03
glioblastoma -5.400 6.2e-09
group 4 medulloblastoma -6.600 4.7e-11
atypical teratoid / rhabdoid tumor -3.400 1.6e-04
medulloblastoma, large-cell -6.400 3.0e-08
primitive neuroectodermal tumor -3.400 7.0e-04
adrenocortical carcinoma 3.198 3.3e-02
non-small cell lung cancer 1.945 1.4e-05
cystic fibrosis 1.100 2.6e-02
adult high grade glioma -6.500 5.2e-10
pilocytic astrocytoma -5.800 5.3e-10
Pick disease -1.300 5.9e-03

Synonym

Accession P05937 B2R696 B7Z9J4
Symbols CALB
D-28K

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (24)

PMID Text
26417681 Age-related loss of CB appears to coincide with tangle formation in the BFCN and is associated with the full range of tau pathology, including late appearing epitopes.
26081613 Increased number of calbindin neurons and fiber labeling both in focal cortical dysplasia (FCD) and non-FCD specimens compared with postmortem controls may be associated with ongoing seizure activity.
24719368 expressed by different neuron types, both inhibitory (GABAergic) and excitatory (glutamatergic), involved in both intrinsic and extrinsic circuits of the human cerebellar cortex
23715974 The calbindin-D 28k was decreased in the putamen, the dorsal tier of the substantia nigra along the lower border of the red nucleus, and in the cerebellar cortex in multiple system atrophy.
22483853 Significantly reduced hippocampal calbindin D28K levels are found in all patients with mitochondrial encephalomyopathy, lactic acidosis and stroke-like syndrome (MELAS).
22272358 Data show calbindin (CB)- and tyrosine hydroxylase (TH)-cells were distributed in the three striatal territories, and the density of calretinin (CR) and parvalbumin (PV) interneurons were more abundant in the associative and sensorimotor striatum.
21364983 Dynamics of Ca2+ ions within the solvation shell of calbindin D9k.
20452033 upregulated in endometriosis tissues
20214988 cultured syncytiotrophoblast cells express calbindin-D9k and calbindin-D28k genes, which are stimulated by calcitriol
20054781 calbindin may play a role in development of Purkinje cells located in heterotopias and cerebellar dysgenesias
19674066 Our study shows there is no association between rs1805874 and risk for Parkinson's disease (PD) in four Caucasian populations. This suggests the effect of calbindin on PD risk displays population specificity.
19674066 Observational study of gene-disease association. (HuGE Navigator)
18587625 No significant differences in cerebellar Purkinje cells in levels of CALB in autism or in the normal cerebellum.
18568448 CALB1 is associated with Parkinson's disease independently of alpha-synuclein.
18568448 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18359862 calbindin D(28k) binds Zn2+ to 3 rather strong sites with dissociation constants in low micromolar range. Zn2+-bound state is structurally distinct from Ca2+-bound state, with negative allosteric interaction between Zn- & Ca-binding events.
18259068 recombinant human calbindin-D28k was crystallized at 291 K using PEG 3350 as precipitant and a 2.4 A resolution X-ray data set was collected from a single flash-cooled crystal
17442486 aggregates of mutant ataxin-l may recruit calbindin-D28k via tissue transglutaminase 2 mediated covalent crosslinking
17156698 Our findings indicate that the expression of parvalbumin or calbindin-D(28k) by subpopulations of dysplastic neurons in cortical tubers is aberrant and denotes dysfunctional inhibitory circuits inept for excitoprotection.
15741335 Post-translational modifications of human calbindin.
15641794 The biological function of calbindin D28k appears to be tied to the redox state of its five cysteine residues.
12606474 calbindin 1, 28kDa may play a role in Ca2+ transport or cell development in human trophoblast possibly trough Ca2+ buffering
12176979 binds to myo-inositol-1(or 4)-monophosphatase (IMPase) and increases the phosphatase activity
11994015 S-nitrosation of Ca(2+)-loaded and Ca(2+)-free recombinant calbindin D(28K) from human brain.

AA Sequence

MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDD      1 - 70
GKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDD     71 - 140
TKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENE    141 - 210
LDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN                       211 - 261
//

Text Mined References (44)

PMID Year Title
26417681 2015 Loss of calbindin-D28K is associated with the full range of tangle pathology within basal forebrain cholinergic neurons in Alzheimer's disease.
26081613 2015 Calcium-binding proteins in focal cortical dysplasia.
24719368 2014 Calbindin-D28K immunoreactivity in the human cerebellar cortex.
23715974 2013 Loss of DARPP-32 and calbindin in multiple system atrophy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22796338 2012 Correlation between calbindin expression in granule cells of the resected hippocampal dentate gyrus and verbal memory in temporal lobe epilepsy.
22483853 2012 Decreased hippocampal expression of calbindin D28K and cognitive impairment in MELAS.
22272358 2012 Distribution of GABAergic interneurons and dopaminergic cells in the functional territories of the human striatum.
21364983 2011 The dynamics of Ca2+ ions within the solvation shell of calbindin D9k.
21269460 2011 Initial characterization of the human central proteome.
20452033 2010 DNA microarray analysis in a mouse model for endometriosis and validation of candidate factors with human adenomyosis.
20214988 2010 Effects of calcitriol on calbindins gene expression and lipid peroxidation in human placenta.
20098747 2010 Expanding the substantial interactome of NEMO using protein microarrays.
20054781 2009 Calbindin positive Purkinje cells in the pathology of human cerebellum occurring at the time of its development.
19674066 2010 Calbindin-1 association and Parkinson's disease.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18587625 2008 Cerebellar Purkinje cells are reduced in a subpopulation of autistic brains: a stereological experiment using calbindin-D28k.
18568448 2008 Calbindin 1, fibroblast growth factor 20, and alpha-synuclein in sporadic Parkinson's disease.
18359862 2008 Zn2+ binding to human calbindin D(28k) and the role of histidine residues.
18259068 2008 Crystallization and preliminary crystallographic analysis of human Ca 2+-loaded calbindin-D28k.
17442486 2007 Role of tissue transglutaminase type 2 in calbindin-D28k interaction with ataxin-1.
17156698 2006 Anomalous inhibitory circuits in cortical tubers of human tuberous sclerosis complex associated with refractory epilepsy: aberrant expression of parvalbumin and calbindin-D28k in dysplastic cortex.
16928804 2006 Expression of the ammonia transporter, rh C glycoprotein, in normal and neoplastic human kidney.
16763551 2006 Calbindin-D28K dynamically controls TRPV5-mediated Ca2+ transport.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15741335 2005 Deamidation and disulfide bridge formation in human calbindin D28k with effects on calcium binding.
15641794 2005 Redox sensitive cysteine residues in calbindin D28k are structurally and functionally important.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12684061 2003 Calbindin D28K interacts with Ran-binding protein M: identification of interacting domains by NMR spectroscopy.
12606474 2003 Expression of calbindin-D28k (CaBP28k) in trophoblasts from human term placenta.
12520521 2003 Vitamin D target proteins: function and regulation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12176979 2002 Myo-inositol monophosphatase is an activated target of calbindin D28k.
10841767 2000 Ca(2+)- and H(+)-dependent conformational changes of calbindin D(28k).
9373717 1997 Localization of calbindin-D28k in normal and incised mouse skin: immunohistochemical and immunoblot analysis.
8739042 1996 Calbindin D28K forms a Ca(2+)-dissociable complex with mellitin in vitro.
7943215 1994 Immunohistochemical localization of the 1,25(OH)2D3 receptor and calbindin D28k in human and rat pancreas.
3691519 1987 Human 27-kDa calbindin complementary DNA sequence. Evolutionary and functional implications.
2897519 1988 Loss of matrix calcium-binding protein-containing neurons in Huntington's disease.
2565876 1989 The human calbindin 27-kDa gene: structural organization of the 5' and 3' regions, chromosomal assignment, and restriction fragment length polymorphism.
1906795 1991 The human calbindin D28k (CALB1) and calretinin (CALB2) genes are located at 8q21.3----q22.1 and 16q22----q23, respectively, suggesting a common duplication with the carbonic anhydrase isozyme loci.
1713126 1991 Subtractive cloning of a hybrid human endogenous retrovirus and calbindin gene in the prostate cell line PC3.
1537319 1992 Estrogen inhibits calbindin-D28k expression in mouse uterus.