Property Summary

NCBI Gene PubMed Count 27
PubMed Score 23.63
PubTator Score 15.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -2.300 9.0e-07
cutaneous lupus erythematosus -1.600 9.5e-03
psoriasis -2.200 1.7e-04
osteosarcoma 1.003 2.7e-04
glioblastoma -2.100 1.2e-05
atypical teratoid / rhabdoid tumor -4.300 3.0e-13
sonic hedgehog group medulloblastoma -2.100 1.5e-03
medulloblastoma, large-cell -2.800 1.1e-05
primitive neuroectodermal tumor -1.900 7.2e-03
primary pancreatic ductal adenocarcinoma -1.019 3.2e-03
cystic fibrosis 2.200 1.4e-03
adult high grade glioma -2.300 6.3e-04
pituitary cancer 2.200 1.6e-05

Gene RIF (14)

PMID Text
24112238 Nectin-based cell-cell adhesion was formed at the apical side of the junctional adhesion molecule (JAM)-based cell-cell adhesion; cadherin and claudin were recruited to the nectin-3 and JAM-based cell-cell adhesion sites to form AJ- and TJ-like domains.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21325282 Findings clearly reveal the structural basis for the cis-dimerization of nectins through the first Ig-like domains.
20598232 A link might exist between NECL1 and the extracellular matrix protein OPN in inhibiting the migration and invasion of U251 glioma ce
20237496 Observational study of gene-disease association. (HuGE Navigator)
20078932 NECL1 can inhibit the migration and invasion of glioma cells and induce differentiation.
19565570 Nec- 1 suppress the growth and tumorigenic ability of colon cancer cells.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19062177 suggests that NECL1 may act as a tumor suppressor in glioma and loss of it in glioma may be caused by histone deacetylation
18686605 NECL1 may inhibit the proliferation of T98G cells by inducing its apoptosis.
18502984 Expression of entry receptors nectin-1 and HVEM prevent entry of HSV-1 into human conjunctival epithelium.
18420026 human NECL1 is an N-linked glycoprotein with a single glycosylation site at position N290KS
16467305 crystallographic analysis of human Nectin-like molecule-1/Syncam3/Tsll1/Igsf4b, a neural tissue-specific immunoglobulin-like cell-cell adhesion molecule
15741237 Necl-1 is a neural-tissue-specific Ca2+-independent immunoglobulin-like cell-cell adhesion molecule which potentially has membrane-associated guanylate kinase subfamily member-binding activity and localizes at the non-junctional cell-cell contact sites

AA Sequence

MGAPAASLLLLLLLFACCWAPGGANLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTL      1 - 70
YFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKS     71 - 140
SLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCS    141 - 210
VNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQ    211 - 280
ESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYHAIIGGIVAFIVFLLLIMLIF    281 - 350
LGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGGQSGGDDKKEYFI                          351 - 398
//

Text Mined References (27)

PMID Year Title
24112238 2013 Nectin and junctional adhesion molecule are critical cell adhesion molecules for the apico-basal alignment of adherens and tight junctions in epithelial cells.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22291609 2012 A genome-wide association scan on the levels of markers of inflammation in Sardinians reveals associations that underpin its complex regulation.
21325282 2011 Crystal Structure of the cis-Dimer of Nectin-1: implications for the architecture of cell-cell junctions.
20598232 2010 Nectin-like molecule 1 inhibits the migration and invasion of U251 glioma cells by regulating the expression of an extracellular matrix protein osteopontin.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20078932 2009 [Neural adhesion molecule NECL1 inhibits migration, invasion, and potentially induces differentiation of glioma cell].
19565570 2009 The cell adhesion nectin-like molecules (Necl) 1 and 4 suppress the growth and tumorigenic ability of colon cancer cells.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19062177 2009 Loss of NECL1, a novel tumor suppressor, can be restored in glioma by HDAC inhibitor-Trichostatin A through Sp1 binding site.
18686605 2008 [Effect of NECL1 on the proliferation of T98G glioma cell line].
18502984 2008 HVEM and nectin-1 are the major mediators of herpes simplex virus 1 (HSV-1) entry into human conjunctival epithelium.
18420026 2008 Nectin-like molecule 1 is a glycoprotein with a single N-glycosylation site at N290KS which influences its adhesion activity.
17903293 2007 Genome-wide association with select biomarker traits in the Framingham Heart Study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16467305 2006 Crystal structure of the V domain of human Nectin-like molecule-1/Syncam3/Tsll1/Igsf4b, a neural tissue-specific immunoglobulin-like cell-cell adhesion molecule.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15893517 2005 Nectin-like molecule 1 is a protein 4.1N associated protein and recruits protein 4.1N from cytoplasm to the plasma membrane.
15741237 2005 Nectin-like molecule-1/TSLL1/SynCAM3: a neural tissue-specific immunoglobulin-like cell-cell adhesion molecule localizing at non-junctional contact sites of presynaptic nerve terminals, axons and glia cell processes.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14659875 2003 Isolation of the mouse Tsll1 and Tsll2 genes, orthologues of the human TSLC1-like genes 1 and 2 (TSLL1 and TSLL2).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12826663 2003 Implications of nectin-like molecule-2/IGSF4/RA175/SgIGSF/TSLC1/SynCAM1 in cell-cell adhesion and transmembrane protein localization in epithelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11544254 2001 Nectin4/PRR4, a new afadin-associated member of the nectin family that trans-interacts with nectin1/PRR1 through V domain interaction.
11536053 2001 Isolation of the TSLL1 and TSLL2 genes, members of the tumor suppressor TSLC1 gene family encoding transmembrane proteins.