Property Summary

NCBI Gene PubMed Count 32
PubMed Score 50.00
PubTator Score 38.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.160 2.1e-02
astrocytic glioma -1.400 2.0e-02
ependymoma -1.700 3.5e-02
psoriasis -1.200 2.2e-04
osteosarcoma -2.492 1.1e-09
glioblastoma -1.300 2.4e-04
medulloblastoma -1.100 3.8e-05
medulloblastoma, large-cell -1.100 9.4e-06
intraductal papillary-mucinous neoplasm ... 1.500 2.1e-03
lung cancer 1.600 8.3e-04
pilocytic astrocytoma -1.100 5.3e-06
subependymal giant cell astrocytoma -1.086 2.6e-02
Breast cancer 1.200 1.2e-07

Gene RIF (22)

PMID Text
26825673 CacyBP/SIP plays an important role in inhibiting apoptosis of glioma cells which might be mediated by ERK1/2 signaling pathway.
26603518 CacyBP/SIP is a useful indicator of dis processes in Chronic Lymphocytic Leukemia (CLL) and plays an important role in sustaining the balance of cell proliferation and apoptosis.
25110433 CacyBP/SIP nuclear translocation promotes the proliferation and cell cycle progression of gastric cancer cells.
24740456 Overexpression of CacyBP is associated with glioma.
23543800 This study presents CacyBP as a promising candidate biomarker for colorectal cancer (CRC) metastasis and also sheds light on the underlying molecular mechanism by which CacyBP promotes CRC metastasis.
23463283 CacyBP enhances multidrug resistance of pancreatic cancer cells by regulation of P-gp and Bcl-2.
23166591 Expression of HIV-1 Tat upregulates the abundance of calcyclin binding protein (CACYBP) in the nucleoli of Jurkat T-cells
22874833 These findings reveal a novel function for SNRK in the regulation of colon cancer cell proliferation and beta-catenin signaling.
22480271 different activity of CacyBP/SIP in neuroblastoma NB2a and colon cancer HCT116 cells might affect the ERK1/2 pathway in the differentiation or proliferation processes
22295074 new insight into the interaction between S100 proteins and CacyBP/SIP
21297076 CACYBP is associated with acute lung injury in mice
21268134 Data show that CacyBP/SIP might develop into another possible therapeutic target.
21110948 CacyBP/SIP exhibits a phosphatase activity toward ERK1/2 kinases while its E217K mutant does not.
20878073 CacyBP regulation of COX-2 expression may play an important role in human breast carcinogenesis
20585948 Poor cellular differentiation, lymph node invasion, and clinicopathological staging in breast cancer were associated with CacyBP/SIP expression.
18765951 CacyBP/SIP protein might play an important role in the process of pancreatic carcinogenesis and high-level CacyBP/SIP expression might be related to the malignant potential of pancreatic cancer.
18443365 The first study on the CacyBP/SIP expression pattern in a broad range of human normal and tumor tissues.
18171983 CacyBP/SIP may be a potential inhibitor of cell growth and invasion in the gastric cancer cell, at least in part through the effect on beta-catenin protein expression and transcriptional activation of Tcf/LEF
17400182 Taken together, our work showed that CacyBP/SIP, as a novel down-regulated gene in renal cell carcinoma, suppressed proliferation and tumorigenesis of renal cancer cells.
16085652 SIP engages Siah1 by means of two elements, both of which are required for mediating beta-catenin destruction in cells
12895292 the translocation of CacyBP during the retinoic acid-induced differentiation of neuroblastoma SH-SY5Y cells suggested that this protein might play a role in neuronal differentiation
12421809 investigation of interaction with Siah1

AA Sequence

MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITTG      1 - 70
YTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNLNGKSYSMIVNNLLKPISVEG     71 - 140
SSKKVKTDTVLILCRKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVLKKIYEDGDDDMKRTI    141 - 210
NKAWVESREKQAKGDTEF                                                        211 - 228
//

Text Mined References (41)

PMID Year Title
26825673 2016 CacyBP/SIP inhibits Doxourbicin-induced apoptosis of glioma cells due to activation of ERK1/2.
26603518 2016 Expression and regulation of CacyBP/SIP in chronic lymphocytic leukemia cell balances of cell proliferation with apoptosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25110433 2014 CacyBP/SIP nuclear translocation induced by gastrin promotes gastric cancer cell proliferation.
24740456 2014 CacyBP/SIP protein is important for the proliferation of human glioma cells.
23543800 2013 iTRAQ based quantitative proteomics approach validated the role of calcyclin binding protein (CacyBP) in promoting colorectal cancer metastasis.
23463283 2013 CacyBP/SIP enhances multidrug resistance of pancreatic cancer cells by regulation of P-gp and Bcl-2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22874833 2012 Snf1-related kinase inhibits colon cancer cell proliferation through calcyclin-binding protein-dependent reduction of ?-catenin.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22480271 2012 CacyBP/SIP phosphatase activity in neuroblastoma NB2a and colon cancer HCT116 cells.
22295074 2012 S100A6 protein negatively regulates CacyBP/SIP-mediated inhibition of gastric cancer cell proliferation and tumorigenesis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21297076 2011 Haplotype association mapping of acute lung injury in mice implicates activin a receptor, type 1.
21269460 2011 Initial characterization of the human central proteome.
21268134 2011 CacyBP/SIP protein promotes proliferation and G1/S transition of human pancreatic cancer cells.
21110948 2011 ERK1/2 is dephosphorylated by a novel phosphatase--CacyBP/SIP.
20878073 2010 Down-regulation of CacyBP is associated with poor prognosis and the effects on COX-2 expression in breast cancer.
20585948 2010 CacyBP/SIP expression is involved in the clinical progression of breast cancer.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18765951 2008 Expression and clinical significance of CacyBP/SIP in pancreatic cancer.
18443365 2008 Expression of calcyclin-binding protein/Siah-1 interacting protein in normal and malignant human tissues: an immunohistochemical survey.
18171983 2007 Calcyclin-binding protein inhibits proliferation, tumorigenicity, and invasion of gastric cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17400182 2007 Overexpressed CacyBP/SIP leads to the suppression of growth in renal cell carcinoma.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16085652 2005 Structural analysis of Siah1-Siah-interacting protein interactions and insights into the assembly of an E3 ligase multiprotein complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12895292 2003 Translocation and phosphorylation of calcyclin binding protein during retinoic acid-induced neuronal differentiation of neuroblastoma SH-SY5Y cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421809 2003 Structural analysis of Siah1 and its interactions with Siah-interacting protein (SIP).
12042313 2002 CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family.
12006993 2002 [Cloning and expression of human calcyclin binding protein (hCacyBP) gene].
11927578 2002 Ca2+-dependent translocation of the calcyclin-binding protein in neurons and neuroblastoma NB-2a cells.
11389839 2001 Siah-1, SIP, and Ebi collaborate in a novel pathway for beta-catenin degradation linked to p53 responses.