Property Summary

NCBI Gene PubMed Count 35
PubMed Score 55.01
PubTator Score 38.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.400 2.0e-02
Breast cancer 1.200 1.2e-07
ependymoma -1.700 3.5e-02
glioblastoma -1.200 4.3e-03
intraductal papillary-mucinous neoplasm ... 1.500 2.1e-03
lung cancer 1.600 8.3e-04
medulloblastoma -1.100 3.8e-05
medulloblastoma, large-cell -1.100 9.4e-06
Multiple myeloma 1.160 2.1e-02
osteosarcoma -2.492 1.1e-09
Pilocytic astrocytoma -1.100 5.3e-06
psoriasis -1.200 2.2e-04
subependymal giant cell astrocytoma -1.086 2.6e-02

Gene RIF (25)

AA Sequence

MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITTG      1 - 70
YTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNLNGKSYSMIVNNLLKPISVEG     71 - 140
SSKKVKTDTVLILCRKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVLKKIYEDGDDDMKRTI    141 - 210
NKAWVESREKQAKGDTEF                                                        211 - 228
//

Text Mined References (44)

PMID Year Title