Property Summary

NCBI Gene PubMed Count 21
PubMed Score 19.03
PubTator Score 4.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
glioblastoma 5635 5.9e-06
medulloblastoma, large-cell 6086 1.8e-05
adult high grade glioma 3701 5.6e-05
osteosarcoma 7766 9.0e-04
ependymoma 4559 5.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Liver cancer 589 0.0 0.5
Disease Target Count Z-score Confidence
Dilated cardiomyopathy 56 3.38 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.500 5.6e-05
ependymoma 1.400 5.6e-03
glioblastoma 1.100 5.9e-06
medulloblastoma, large-cell 1.100 1.8e-05
osteosarcoma 1.145 9.0e-04

 GO Function (1)

Gene RIF (5)

AA Sequence

MGRDTRSRSRSAGRRGRRRQSQSGSRSRSRSHGRRNRRRREDEGRRRRRRRSRERRSDSEEERWQRSGMR      1 - 70
SRSPPRPKWHSRDGSSQSDSGEEQSRGQWARRRRRARSWSPSSSASSSASPGRSQSPRAAAAALSQQQSL     71 - 140
QERLRLREERKQQEELMKAFETPEEKRARRLAKKEAKERKKREKMGWGEEYMGYTNTDNPFGDNNLLGTF    141 - 210
IWNKALEKKGISHLEEKELKERNKRIQEDNRLELQKVKQLRLEREREKAMREQELEMLQREKEAEHFKTW    211 - 280
EEQEDNFHLQQAKLRSKIRIRDGRAKPIDLLAKYISAEDDDLAVEMHEPYTFLNGLTVADMEDLLEDIQV    281 - 350
YMELEQGKNADFWRDMTTITEDEISKLRKLEASGKGPGERREGVNASVSSDVQSVFKGKTYNQLQVIFQG    351 - 420
IEGKIRAGGPNLDMGYWESLLQQLRAHMARARLRERHQDVLRQKLYKLKQEQGVESEPLFPILKQEPQSP    421 - 490
SRSLEPEDAAPTPPGPSSEGGPAEAEVDGATPTEGDGDGDGEGEGEGEAVLMEEDLIQQSLDDYDAGRYS    491 - 560
PRLLTAHELPLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTGK    561 - 630
AYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACA    631 - 700
DNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR                701 - 758
//

Text Mined References (24)

PMID Year Title