Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.88
PubTator Score 2.28

Knowledge Summary

Patent (613)

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 3.780 4.9e-11
atypical teratoid / rhabdoid tumor 1.100 8.1e-03
medulloblastoma, large-cell 1.400 1.2e-05
adult high grade glioma 1.200 2.2e-03
ovarian cancer 1.400 1.4e-11

 MGI Phenotype (1)

Protein-protein Interaction (6)

Gene RIF (2)

PMID Text
20860846 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20860846 CACNG6 variants might be associated with the risk of aspirin-intolerant asthma in a Korean population.

AA Sequence

MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKA      1 - 70
NGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFFTTGENARIFQRTTKKEVNLA     71 - 140
AAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGLSGLLLLVSLEVFRHSVRALLQRVSPEPPPA    141 - 210
PRLTYEYSWSLGCGVGAGLILLLGAGCFLLLTLPSWPWGSLCPKRGHRAT                        211 - 260
//

Text Mined References (6)

PMID Year Title
20860846 2010 Association of CACNG6 polymorphisms with aspirin-intolerance asthmatics in a Korean population.
17652770 2007 Calcium channel gamma subunits: a functionally diverse protein family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11738816 2001 Calcium channel gamma subunits provide insights into the evolution of this gene family.
11170751 2001 A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family.