Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.95
PubTator Score 0.51

Knowledge Summary

Patent (593)

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
oligodendroglioma 2.000 1.4e-02
psoriasis 2.700 5.0e-05
osteosarcoma 4.192 1.9e-12
glioblastoma 1.700 1.0e-03
primitive neuroectodermal tumor 1.700 2.4e-02
pediatric high grade glioma 1.400 1.0e-03
pilocytic astrocytoma 2.300 2.4e-06
lung carcinoma -1.100 3.9e-11

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20378664 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
14505496 examined distribution of the stargazin-like proteins gamma2, gamma3, and gamma4 in human CNS: gamma2 is expressed in cerebellum, cerebral cortex, hippocampus and thalamus, whereas gamma3 abounds in cerebral cortex & amygdala and gamma4 in basal ganglia

AA Sequence

MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHSGLWRVC      1 - 70
CIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLLGGLCIGAGRIYSRKNNIVLS     71 - 140
AGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNHYNYGWSFYFGALSFIVAETVGVLAVNIYIEKN    141 - 210
KELRFKTKREFLKASSSSPYARMPSYRYRRRRSRSSSRSTEASPSRDVSPMGLKITGAIPMGELSMYTLS    211 - 280
REPLKVTTAASYSPDQEASFLQVHDFFQQDLKEGFHVSMLNRRTTPV                           281 - 327
//

Text Mined References (13)

PMID Year Title
21172611 2010 Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20378664 2010 Analysis of multiple candidate genes in association with phenotypes of multiple sclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18304745 2009 Functional modulation of AMPA receptors by transmembrane AMPA receptor regulatory proteins.
17652770 2007 Calcium channel gamma subunits: a functionally diverse protein family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14505496 2003 Human neuronal stargazin-like proteins, gamma2, gamma3 and gamma4; an investigation of their specific localization in human brain and their influence on CaV2.1 voltage-dependent calcium channels expressed in Xenopus oocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11738816 2001 Calcium channel gamma subunits provide insights into the evolution of this gene family.
11170751 2001 A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family.
10613843 1999 Identification of three novel Ca(2+) channel gamma subunit genes reveals molecular diversification by tandem and chromosome duplication.