Property Summary

NCBI Gene PubMed Count 35
PubMed Score 89.64
PubTator Score 54.41

Knowledge Summary

Patent (1,731)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.000 1.2e-06
astrocytoma -1.200 1.7e-02
Astrocytoma, Pilocytic -2.200 5.0e-09
atypical teratoid / rhabdoid tumor -2.300 9.6e-11
ependymoma -2.500 1.5e-22
glioblastoma -2.200 8.1e-12
lung carcinoma 2.900 9.6e-35
medulloblastoma, large-cell -1.100 1.4e-02
primitive neuroectodermal tumor -2.700 8.8e-07
psoriasis -1.600 3.1e-04
subependymal giant cell astrocytoma -1.136 3.2e-02

Gene RIF (18)

AA Sequence

MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTHSGLWRTCCLE      1 - 70
GNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGLCIAASEFYKTRHNIILSAGI     71 - 140
FFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSFYFGALSFIIAEMVGVLAVHMFIDRHKQLRA    141 - 210
TARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKA    211 - 280
ATTPTATYNSDRDNSFLQVHNCIQKENKDSLHSNTANRRTTPV                               281 - 323
//

Text Mined References (36)

PMID Year Title