Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.54
PubTator Score 8.45

Knowledge Summary

Patent (308)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 4.7e-04
psoriasis 6685 2.9e-02
Disease Target Count Z-score Confidence
Malignant hyperthermia 25 4.05 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.019 4.7e-04
psoriasis -1.100 2.9e-02

 MGI Phenotype (1)

Protein-protein Interaction (6)

Gene RIF (1)

PMID Text
18187620 Knockdown of calcium channel, voltage-dependent, gamma subunit 1 (CACNG1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MSQTKMLKVRVTLFCILAGIVLAMTAVVTDHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCG      1 - 70
PITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIILGSLCVLLSLGKKRDYLLRPA     71 - 140
SMFYAFAGLCILVSVEVMRQSVKRMIDSEDTVWIEYYYSWSFACACAAFILLFLGGLALLLFSLPRMPRN    141 - 210
PWESCMDAEPEH                                                              211 - 222
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17652770 2007 Calcium channel gamma subunits: a functionally diverse protein family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11738816 2001 Calcium channel gamma subunits provide insights into the evolution of this gene family.
11170751 2001 A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family.
10613843 1999 Identification of three novel Ca(2+) channel gamma subunit genes reveals molecular diversification by tandem and chromosome duplication.
9186513 1997 A somatic cell hybrid panel for distal 17q: GDIA1 maps to 17q25.3.
8404045 1993 Localization of the gamma-subunit of the skeletal muscle L-type voltage-dependent calcium channel gene (CACNLG) to human chromosome band 17q24 by in situ hybridization and identification of a polymorphic repetitive DNA sequence at the gene locus.
8395940 1993 Genetic mapping of the beta 1- and gamma-subunits of the human skeletal muscle L-type voltage-dependent calcium channel on chromosome 17q and exclusion as candidate genes for malignant hyperthermia susceptibility.
8387489 1993 Molecular characterization of the gene encoding the gamma subunit of the human skeletal muscle 1,4-dihydropyridine-sensitive Ca2+ channel (CACNLG), cDNA sequence, gene structure, and chromosomal location.
8111396 1993 G to A polymorphism in the CACNLG gene.