Property Summary

NCBI Gene PubMed Count 36
PubMed Score 35.59
PubTator Score 17.93

Knowledge Summary

Patent (5,640)

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.600 2.7e-05
astrocytic glioma -1.400 1.8e-02
Astrocytoma, Pilocytic -1.700 2.2e-08
atypical teratoid / rhabdoid tumor -2.200 2.0e-07
ependymoma -2.000 1.3e-02
glioblastoma -1.900 5.0e-11
group 3 medulloblastoma -1.800 1.2e-03
lung cancer -1.300 3.0e-03
medulloblastoma, large-cell -2.100 1.3e-05
oligodendroglioma -1.500 2.4e-02
ovarian cancer 1.100 3.1e-07
Pick disease -1.200 1.6e-03
primitive neuroectodermal tumor -1.800 1.8e-04
psoriasis 1.800 3.2e-72

 IMPC Phenotype (1)

Protein-protein Interaction (4)

Gene RIF (11)

AA Sequence

MSSSSYAKNGTADGPHSPTSQVARGTTTRRSRLKRSDGSTTSTSFILRQGSADSYTSRPSDSDVSLEEDR      1 - 70
EAIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDEDVPVPSTAISFDAKDFLHIKEKYNNDWWIGR     71 - 140
LVKEGCEIGFIPSPLRLENIRIQQEQKRGRFHGGKSSGNSSSSLGEMVSGTFRATPTSTAKQKQKVTEHI    141 - 210
PPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAII    211 - 280
ERSNTRSSLAEVQSEIERIFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRG    281 - 350
KSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATHTTSSTPMTPLLGRNLGS    351 - 420
TALSPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQHSRDHYPLVEE    421 - 490
DYPDSYQDTYKPHRNRGSPGGYSHDSRHRL                                            491 - 520
//

Text Mined References (36)

PMID Year Title