Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.01
PubTator Score 14.36

Knowledge Summary

Patent (1,727)

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -3.100 5.5e-05
Alzheimer's disease -1.300 4.3e-02
astrocytic glioma -2.600 2.0e-03
Astrocytoma, Pilocytic -2.900 3.4e-07
atypical teratoid / rhabdoid tumor -2.900 1.3e-03
ependymoma -2.800 2.2e-03
glioblastoma -3.100 2.3e-09
group 4 medulloblastoma -1.800 1.8e-02
lung adenocarcinoma -1.200 9.1e-17
medulloblastoma, large-cell -3.800 1.2e-04
oligodendroglioma -2.200 1.2e-02
osteosarcoma -2.570 3.4e-08
ovarian cancer -1.300 1.3e-03
Pick disease -2.100 5.6e-04
pituitary cancer 1.700 2.2e-02
psoriasis 1.200 2.8e-56
Rheumatoid arthritis -1.100 2.6e-02
tuberculosis 2.700 2.8e-05

Protein-protein Interaction (7)

Gene RIF (15)

AA Sequence

MAGPGSPRRASRGASALLAAALLYAALGDVVRSEQQIPLSVVKLWASAFGGEIKSIAAKYSGSQLLQKKY      1 - 70
KEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEEAHLKHEFDADLQYEYFNAVLINERD     71 - 140
KDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLI    141 - 210
WQYFGSAKGFFRQYPGIKWEPDENGVIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVS    211 - 280
SILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILS    281 - 350
DFNHTGQGSICSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQ    351 - 420
ISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLTDDQGPVLMTTVAMPVFSKQNET    421 - 490
RSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELRLLYEEGKKRRKPNYSSVDLS    491 - 560
EVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYYYTDIKGTPFSLGVALSRGHGKYFFR    561 - 630
GNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVV    631 - 700
SAPIEAYWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWY    701 - 770
RRAAEQIPGSFVYSIPFSTGPVNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCAS    771 - 840
LDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEIEGAVMNKLLTMGSFKRITLYDYQAMCRAN    841 - 910
KESSDGAHGLLDPYNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDTEYPAFVSER    911 - 980
TIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRYNESLKCERLKAQKIRR    981 - 1050
RPESCHGFHPEENARECGGAPSLQAQTVLLLLPLLLMLFSR                                1051 - 1091
//

Text Mined References (27)

PMID Year Title